Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-thyro

Mus musculus thyroglobulin cDNA

Comment
Mus musculus AKR/J normal thyroglobulin mouse-a6p7m8 Mus musculus (Mouse) kidney thyroglobulin variant only c-term Pfam A COesterase 2182 2717 here only homologous region starting with first G in cholinesterase 2223


Relationship
Family|Thyroglobulin
Block| C
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
1 mutation: mouse-thyro
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 5 more: BC111467, MMU76389, AF076187
3 UniProt : O08710, A6P7M8, F6XYF6
2 Ncbi-nid : 2055387, 3319331
3 Ncbi-pid : 2055388, 3319332, 3319330
3 UniProt : O08710, A6P7M8, F6XYF6
3 Interpro : O08710, A6P7M8, F6XYF6
3 Prodom : O08710, A6P7M8, F6XYF6
3 Pfam : O08710, A6P7M8, F6XYF6
3 PIRSF : O08710, A6P7M8, F6XYF6
3 SUPERFAM : O08710, A6P7M8, F6XYF6
1 MGD : 98733
2 ENSEMBL : O08710, ENSMUSG00000053469
Sequence
Graphical view for this peptide sequence: mouse-thyro
Colored MSA for Thyroglobulin (raw)
FGQLQGGSQVIKVGTAWKQVYRFLGVPYAAPPLADNRFRAPEVLNWTGSW
DATKPRASCWQPGTRTPTPPQINEDCLYLNVFVPENLVSNASVLVFFHNT
MEMEGSGGQLTIDGSILAAVGNFIVVTANYRLGVFGFLSSGSDEVAGNWG
LLDQVAALTWVQSHIGAFGGDPQRVTLAADRSGADVASIHLLISRPTRLQ
LFRKALLMGGSALSPAAIISPERAQQQAAALAKEVGCPTSSIQEVVSCLR
QKPANILNDAQTKLLAVSGPFHYWGPVVDGQYLRELPSRRLKRPLPVKVD
LLIGGSQDDGLINRAKAVKQFEESQGRTNSKTAFYQALQNSLGGEDSDAR
ILAAAVWYYSLEHSTDDYASFSRALENATRDYFIICPMVNMASLWARRTR
GNVFMYHVPESYGHGSLELLADVQYAFGLPFYSAYQGQFSTEEQSLSLKV
MQYFSNFIRSGNPNYPHEFSRKAAEFATPWPDFIPGAGGESYKELSAQLP
NRQGLKQADCSFWSKYIQTLKDADGAKDAQLTKSEEEDLEVGPGLEEDLS
GSLEPVPKSYSK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

FGQLQGGSQVIKVGTAWKQVYRFLGVPYAAPPLADNRFRAPEVLNWTGSW
DATKPRASCWQPGTRTPTPPQINEDCLYLNVFVPENLVSNASVLVFFHNT
MEMEGSGGQLTIDGSILAAVGNFIVVTANYRLGVFGFLSSGSDEVAGNWG
LLDQVAALTWVQSHIGAFGGDPQRVTLAADRSGADVASIHLLISRPTRLQ
LFRKALLMGGSALSPAAIISPERAQQQAAALAKEVGCPTSSIQEVVSCLR
QKPANILNDAQTKLLAVSGPFHYWGPVVDGQYLRELPSRRLKRPLPVKVD
LLIGGSQDDGLINRAKAVKQFEESQGRTNSKTAFYQALQNSLGGEDSDAR
ILAAAVWYYSLEHSTDDYASFSRALENATRDYFIICPMVNMASLWARRTR
GNVFMYHVPESYGHGSLELLADVQYAFGLPFYSAYQGQFSTEEQSLSLKV
MQYFSNFIRSGNPNYPHEFSRKAAEFATPWPDFIPGAGGESYKELSAQLP
NRQGLKQADCSFWSKYIQTLKDADGAKDAQLTKSEEEDLEVGPGLEEDLS
GSLEPVPKSYSK


References
1 more
    Title: Lineage-specific biology revealed by a finished genome assembly of the mouse
    Church DM, Goodstadt L, Hillier LW, Zody MC, Goldstein S, She X, Bult CJ, Agarwala R, Cherry JL and Ponting CP <21 more author(s)>
    Ref: PLoS Biol, 7:e1000112, 2009 : PubMed

            

    Title: A single amino acid change in the acetylcholinesterase-like domain of thyroglobulin causes congenital goiter with hypothyroidism in the cog/cog mouse: a model of human endoplasmic reticulum storage diseases
    Kim PS, Hossain SA, Park YN, Lee I, Yoo SE, Arvan P
    Ref: Proc Natl Acad Sci U S A, 95:9909, 1998 : PubMed

            

    Title: Cloning and characterization of murine thyroglobulin cDNA
    Caturegli P, Vidalain PO, Vali M, Aguilera-Galaviz LA, Rose NR
    Ref: Unpublished, :, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer