mycle-a85a

 
Mycobacterium leprae (and strain Br4923) Antigen 85A, mycolytransferase

Relationship
Block X
Mycobacterium leprae position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium leprae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 2 more: D43841, M90648, AL583917
1 UniProt : Q05861
1 UniProtTrembl : Q05861
1 Interpro : Q05861
1 Prodom : Q05861
1 Pfam : Q05861
1 PIRSF : Q05861
1 SUPERFAM : Q05861
1 QuickSwissBlast : Q05861
 
Sequence
Graphical view for this peptide sequence: mycle-a85a
Colored MSA for A85-Mycolyl-transferase (raw)
MKFVDRFRGAVAGMLRRLVVEAMGVALLSALIGVVGSAPAEAFSRPGLPV
EYLQVPSPSMGRDIKVQFQNGGANSPALYLLDGLRAQDDFSGWDINTTAF
EWYYQSGISVVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQY
LQSNKQIKPTGSAAVGLSMAGLSALTLAIYHPDQFIYVGSMSGLLDPSNA
MGPSLIGLAMGDAGGYKAADMWGPSTDPAWKRNDPTVNVGTLIANNTRIW
MYCGNGKPTELGGNNLPAKLLEGLVRTSNIKFQDGYNAGGGHNAVFNFPD
SGTHSWEYWGEQLNDMKPDLQQYLGATPGA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKFVDRFRGAVAGMLRRLVVEAMGVALLSALIGVVGSAPAEAFSRPGLPV
EYLQVPSPSMGRDIKVQFQNGGANSPALYLLDGLRAQDDFSGWDINTTAF
EWYYQSGISVVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQY
LQSNKQIKPTGSAAVGLSMAGLSALTLAIYHPDQFIYVGSMSGLLDPSNA
MGPSLIGLAMGDAGGYKAADMWGPSTDPAWKRNDPTVNVGTLIANNTRIW
MYCGNGKPTELGGNNLPAKLLEGLVRTSNIKFQDGYNAGGGHNAVFNFPD
SGTHSWEYWGEQLNDMKPDLQQYLGATPGA

no DNA




References
1 more
    Title: Massive gene decay in the leprosy bacillus
    Cole ST, Eiglmeier K, Parkhill J, James KD, Thomson NR, Wheeler PR, Honore N, Garnier T, Churcher C and Barrell BG <34 more author(s)>
    Ref: Nature, 409:1007, 2001 : PubMed

            

    Title: [Molecular cloning of alpha antigen like protein gene of Mycobacterium leprae and its over production in Escherichia coli]
    Yin Y
    Ref: Kansenshogaku Zasshi, 68:1330, 1994 : PubMed

            

    Title: The Mycobacterium leprae antigen 85 complex gene family: identification of the genes for the 85A, 85C, and related MPT51 proteins
    Rinke de Wit TF, Bekelie S, Osland A, Wieles B, Janson AA, Thole JE
    Ref: Infect Immun, 61:3642, 1993 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer