Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: neucr-B14D6.130

Neurospora crassa B14D6.130

Comment
Q9P5G4 B14D6.240 7899328 are obsolete and removed replaced by Q8X0B4 B14D6.130


Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Neurospora crassa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Sordariomycetidae: N E > Sordariales: N E > Sordariaceae: N E > Neurospora: N E > Neurospora crassa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AL356173, AABX01000128
1 UniProt : Q7RV33
1 Ncbi-nid : 18375977
1 Ncbi-pid : 18375989
2 UniProt : Q8X0B4, Q7RV33
2 Interpro : Q8X0B4, Q7RV33
2 Pfam : Q8X0B4, Q7RV33
2 PIRSF : Q8X0B4, Q7RV33
2 SUPERFAM : Q8X0B4, Q7RV33
Sequence
Graphical view for this peptide sequence: neucr-B14D6.130
Colored MSA for Hormone-sensitive_lipase_like (raw)
MIYLYAARNFSTLVGLASPEPMANMYDAAYFRATWVLTALDAGFWTAMKI
KQKWLRDISSIAFSLFYLVAAEKADEKVRKVRGNLTVEHLRVSWNKGVTS
PYLRFVQNLMRPRFTRWPPRQIRIPRPATSDYKDPVAAWLYYDGPLADLE
YHNKIILDIPGGGFVAMDPRCNDDKLFSWAAKTGLPILSLDYKKAPEFPY
PYALNECYDVYSTIIKTKGRCIGLSGREVPKIVVTGDSAGGTLATSMTLM
IVESGSSPVRRFQGEVNLKVPDGLILFYPALDMNIGSWMSDEQMALIKDR
RMRGTNKRIVQRKTSQYNDLVGTPAPSDDEDDGPSSGPNPEPSLVKEKEP
SSAARSAPEYAHSGPSTWSHADIPSLSSSRSEKSKTTEKQPKAKSSAVAA
TTTPSPTAAPHNHHPQPMRTRLAMSSMISYFADRVLTPEMMRAMIILYVG
PHNRPDFSSDYLLCPILAPDILLSKFPKTYFLTGERDPLVDDTVIFAGRL
KRVKAAMVASDGTRTQYREEDVDEAIRKTNGKWDGKQAAEVALVPGISHG
FLQFAGVYPPAWGLFGKIAGWMGEVFAEAERKEREEERARRKMGVAGGGA
KLEEKAETGAASGRGTNEKGVGFGAVEEHSAEERTGRHHHRRRGTGGTES
SADEDKPLEMGGKARTRGRVALKNAAGSHSEGNTSTSADAMEGMVNQDGI
HHVVKGAEGDEEGGSDTATEAAIAANTKVKAKKAPRRMKLRRVKVGDEDG
ALLVRLDSSDDILGRRMQGLAGGLTGLQEAE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIYLYAARNFSTLVGLASPEPMANMYDAAYFRATWVLTALDAGFWTAMKI
KQKWLRDISSIAFSLFYLVAAEKADEKVRKVRGNLTVEHLRVSWNKGVTS
PYLRFVQNLMRPRFTRWPPRQIRIPRPATSDYKDPVAAWLYYDGPLADLE
YHNKIILDIPGGGFVAMDPRCNDDKLFSWAAKTGLPILSLDYKKAPEFPY
PYALNECYDVYSTIIKTKGRCIGLSGREVPKIVVTGDSAGGTLATSMTLM
IVESGSSPVRRFQGEVNLKVPDGLILFYPALDMNIGSWMSDEQMALIKDR
RMRGTNKRIVQRKTSQYNDLVGTPAPSDDEDDGPSSGPNPEPSLVKEKEP
SSAARSAPEYAHSGPSTWSHADIPSLSSSRSEKSKTTEKQPKAKSSAVAA
TTTPSPTAAPHNHHPQPMRTRLAMSSMISYFADRVLTPEMMRAMIILYVG
PHNRPDFSSDYLLCPILAPDILLSKFPKTYFLTGERDPLVDDTVIFAGRL
KRVKAAMVASDGTRTQYREEDVDEAIRKTNGKWDGKQAAEVALVPGISHG
FLQFAGVYPPAWGLFGKIAGWMGEVFAEAERKEREEERARRKMGVAGGGA
KLEEKAETGAASGRGTNEKGVGFGAVEEHSAEERTGRHHHRRRGTGGTES
SADEDKPLEMGGKARTRGRVALKNAAGSHSEGNTSTSADAMEGMVNQDGI
HHVVKGAEGDEEGGSDTATEAAIAANTKVKAKKAPRRMKLRRVKVGDEDG
ALLVRLDSSDDILGRRMQGLAGGLTGLQEAE


Reference
    Title: The genome sequence of the filamentous fungus Neurospora crassa
    Galagan JE, Calvo SE, Borkovich KA, Selker EU, Read ND, Jaffe D, FitzHugh W, Ma LJ, Smirnov S and Birren B <67 more author(s)>
    Ref: Nature, 422:859, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer