Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: neucr-CBPYA

Neurospora crassa, Sordaria macrospora, Carboxypeptidase Y homolog A

Comment
Other strains: Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) Neurospora tetrasperma(strain FGSC 2508 / ATCC MYA-4615 / P0657), (strain FGSC 2509 / P0656), Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell)


Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Neurospora crassa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Sordariomycetidae: N E > Sordariales: N E > Sordariaceae: N E > Neurospora: N E > Neurospora crassa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AABX01000735
>3 UniProt links 1 more: Q7RXW8, D1ZG13, F8MK53
>3 UniProt links 1 more: Q7RXW8, D1ZG13, F8MK53
>3 Interpro links 1 more: Q7RXW8, D1ZG13, F8MK53
>3 Pfam links 1 more: Q7RXW8, D1ZG13, F8MK53
>3 PIRSF links 1 more: Q7RXW8, D1ZG13, F8MK53
>3 SUPERFAM links 1 more: Q7RXW8, D1ZG13, F8MK53
Sequence
Graphical view for this peptide sequence: neucr-CBPYA
Colored MSA for Carboxypeptidase_S10 (raw)
MRISASTVLLGAASAASAASFQNQAQHVLADNFHKAHDAVKPVADSFAHT
TLESFEEAFNGMNSQAKALWDEIKLLVPENAFDKPTWFSKPKAAKRRKDW
DHVVKGADVQKLWVKGADGEKHREVGGQLDNFNLRVKSVDPSKLGVDKVK
QYSGYLDDEENDKHLFYWFFESRNDPKNDPVVLWLNGGPGCSSLTGLFLE
LGPSSIDKKLRVVSNEYAWNNNASVIFLDQPVNVGYSYSGNAVSNTVAAG
KDVYALLTLFFHQFPEYAKQDFHIAGESYAGHYIPVFASEILSHKDRNIN
LKSVLIGNGLTDPLTQYEHYRPMACGEGGYPAVLSESECRSMDNALPRCQ
SLIRNCYESGSVWSCVPAAIYCNNQFIGPYQRTGQNVYDIRGKCEDDSNL
CYSALGWISDYLNQKDVMDALGVEVEGYESCNFDINRNFLFQGDWMQPFH
RLVPGILKEIPVLIYAGDADFICNWLGNKAWSEALEWPGKNGFNKAELED
LSLPKADKEYGKVKSSGNFTFMQIYQAGHMVPMDQPENSLDFLNRWLGGE
WFEQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRISASTVLLGAASAASAASFQNQAQHVLADNFHKAHDAVKPVADSFAHT
TLESFEEAFNGMNSQAKALWDEIKLLVPENAFDKPTWFSKPKAAKRRKDW
DHVVKGADVQKLWVKGADGEKHREVGGQLDNFNLRVKSVDPSKLGVDKVK
QYSGYLDDEENDKHLFYWFFESRNDPKNDPVVLWLNGGPGCSSLTGLFLE
LGPSSIDKKLRVVSNEYAWNNNASVIFLDQPVNVGYSYSGNAVSNTVAAG
KDVYALLTLFFHQFPEYAKQDFHIAGESYAGHYIPVFASEILSHKDRNIN
LKSVLIGNGLTDPLTQYEHYRPMACGEGGYPAVLSESECRSMDNALPRCQ
SLIRNCYESGSVWSCVPAAIYCNNQFIGPYQRTGQNVYDIRGKCEDDSNL
CYSALGWISDYLNQKDVMDALGVEVEGYESCNFDINRNFLFQGDWMQPFH
RLVPGILKEIPVLIYAGDADFICNWLGNKAWSEALEWPGKNGFNKAELED
LSLPKADKEYGKVKSSGNFTFMQIYQAGHMVPMDQPENSLDFLNRWLGGE
WFEQ


Reference
    Title: The genome sequence of the filamentous fungus Neurospora crassa
    Galagan JE, Calvo SE, Borkovich KA, Selker EU, Read ND, Jaffe D, FitzHugh W, Ma LJ, Smirnov S and Birren B <67 more author(s)>
    Ref: Nature, 422:859, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer