Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: phypa-a0a2k1iji3

Physcomitrella patens subsp. patens (Moss). Peptidase_S9 domain-containing protein

Relationship
Family|Glutamyl_Peptidase_S9
Block| X
Position in NCBI Life Tree|Physcomitrella patens subsp. patens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Bryophyta: N E > Bryophytina: N E > Bryopsida: N E > Funariidae: N E > Funariales: N E > Funariaceae: N E > Physcomitrella: N E > Physcomitrella patens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : ABEU02000023, XP_001772878
1 UniProt : A0A2K1IJI3
1 UniProt : A0A2K1IJI3
1 Interpro : A0A2K1IJI3
1 Pfam : A0A2K1IJI3
1 PIRSF : A0A2K1IJI3
1 SUPERFAM : A0A2K1IJI3
Sequence
Graphical view for this peptide sequence: phypa-a0a2k1iji3
Colored MSA for Glutamyl_Peptidase_S9 (raw)
MGIHDVRNLVALAGTESTAGSATGATNYESTQPADNGYQIPPEEIRKIVD
APPTPTLMFSPTKKTILFLQRRSLAPLSDIARPELKLGGMRIDPEYNTKS
RMSFYTGIHIRKVLSDNNIGEDLVMTGVPEGSRINYCSWSPDGRYFAFSV
REPDQGEGPVTLPSLWVADAETGKARQLLGAPEYALNTVLDHFSWIDDTR
LVVCTIPQGRGAPPKKPPTPFGPKIQSNEGQAVMQNRTYQDLLKDSHDEN
LFEYYATSQIVIVSIDGQALPIGPPALYCDVEASPDGHFLLVRYLHRPFS
FIVHLARFPKKIEVWRPSGEIVKEVCDLPLAEDIPISFDSARKGRRSVNW
RNDKLATLYWVEAQDGGDPKNEVSPRDIVYTEPAEGGFPQVIAETDLRFQ
GICWMDDDLALLYDGWYKTRKTRTWVITPGNPEKEKHILFDRSTEDVYGD
PGSPKRRQSSLGTYVLAQVRNSAGNKCLLLDGRGATPEGNIPFLDLLDIE
TGEKERIWQSVKEKYYETLALLMAPKGDEVLTLDNFKIVIARESQTEPHQ
FYFVCWPAKTETRITNFPHPYPQLKDLNKEIIRYARSDGVQLTATLYTPP
GFDSAKGKLPLLMWAYPREFKSKDNASQMRGSPFSFAGINSTSPLLWLAR
GFAILDGPTMPIIGEGDEEPNERYVEQLVASAKAAVDEVVRRGVADPNKI
AVGGHSYGAFMTANLLIHASDLFACGIARSGAYNRTLTPFGFQAEERTLW
EAQKTYIEMSPYMYANRVKKPLLLIHGDEDNNSGTMTMQSERFFSALKGH
GALTRLVLLPLESHGYQGRESVMHCLWEMDRWLQLHCVNATGNASASDNA
EANPAVTSSGAVGESANENDPFARPSTRGFAALSSL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGIHDVRNLVALAGTESTAGSATGATNYESTQPADNGYQIPPEEIRKIVD
APPTPTLMFSPTKKTILFLQRRSLAPLSDIARPELKLGGMRIDPEYNTKS
RMSFYTGIHIRKVLSDNNIGEDLVMTGVPEGSRINYCSWSPDGRYFAFSV
REPDQGEGPVTLPSLWVADAETGKARQLLGAPEYALNTVLDHFSWIDDTR
LVVCTIPQGRGAPPKKPPTPFGPKIQSNEGQAVMQNRTYQDLLKDSHDEN
LFEYYATSQIVIVSIDGQALPIGPPALYCDVEASPDGHFLLVRYLHRPFS
FIVHLARFPKKIEVWRPSGEIVKEVCDLPLAEDIPISFDSARKGRRSVNW
RNDKLATLYWVEAQDGGDPKNEVSPRDIVYTEPAEGGFPQVIAETDLRFQ
GICWMDDDLALLYDGWYKTRKTRTWVITPGNPEKEKHILFDRSTEDVYGD
PGSPKRRQSSLGTYVLAQVRNSAGNKCLLLDGRGATPEGNIPFLDLLDIE
TGEKERIWQSVKEKYYETLALLMAPKGDEVLTLDNFKIVIARESQTEPHQ
FYFVCWPAKTETRITNFPHPYPQLKDLNKEIIRYARSDGVQLTATLYTPP
GFDSAKGKLPLLMWAYPREFKSKDNASQMRGSPFSFAGINSTSPLLWLAR
GFAILDGPTMPIIGEGDEEPNERYVEQLVASAKAAVDEVVRRGVADPNKI
AVGGHSYGAFMTANLLIHASDLFACGIARSGAYNRTLTPFGFQAEERTLW
EAQKTYIEMSPYMYANRVKKPLLLIHGDEDNNSGTMTMQSERFFSALKGH
GALTRLVLLPLESHGYQGRESVMHCLWEMDRWLQLHCVNATGNASASDNA
EANPAVTSSGAVGESANENDPFARPSTRGFAALSSL


References
    Title: The Physcomitrella patens chromosome-scale assembly reveals moss genome structure and evolution
    Lang D, Ullrich KK, Murat F, Fuchs J, Jenkins J, Haas FB, Piednoel M, Gundlach H, Van Bel M and Rensing SA <46 more author(s)>
    Ref: Plant J, 93:515, 2018 : PubMed

            

    Title: The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants
    Rensing SA, Lang D, Zimmer AD, Terry A, Salamov A, Shapiro H, Nishiyama T, Perroud PF, Lindquist EA and Boore JL <60 more author(s)>
    Ref: Science, 319:64, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer