Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pseae-PA0480

Pseudomonas aeruginosa PA01 (and strains UCBPP-PA14, C3719, 2192; 138244; 39016; 152504; LESB58) PA0480

Comment
Pseudomonas aeruginosa PA01 (and strains UCBPP-PA14, C3719, 2192; 138244; 39016; 152504; LESB58) PA0480. There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|Carboxymethylbutenolide_lactonase
Block| X
Position in NCBI Life Tree|Pseudomonas aeruginosa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas aeruginosa group: N E > Pseudomonas aeruginosa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
3OM8: The crystal structure of a hydrolase from Pseudomonas aeruginosa PA01
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: pseae-PA0480
Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MGNLSFLATSDGASLAYRLDGAAEKPLLALSNSIGTTLHMWDAQLPALTR
HFRVLRYDARGHGASSVPPGPYTLARLGEDVLELLDALEVRRAHFLGLSL
GGIVGQWLALHAPQRIERLVLANTSAWLGPAAQWDERIAAVLQAEDMSET
AAGFLGNWFPPALLERAEPVVERFRAMLMATNRHGLAGSFAAVRDTDLRA
QLARIERPTLVIAGAYDTVTAASHGELIAASIAGARLVTLPAVHLSNVEF
PQAFEGAVLSFLGAA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGNLSFLATSDGASLAYRLDGAAEKPLLALSNSIGTTLHMWDAQLPALTR
HFRVLRYDARGHGASSVPPGPYTLARLGEDVLELLDALEVRRAHFLGLSL
GGIVGQWLALHAPQRIERLVLANTSAWLGPAAQWDERIAAVLQAEDMSET
AAGFLGNWFPPALLERAEPVVERFRAMLMATNRHGLAGSFAAVRDTDLRA
QLARIERPTLVIAGAYDTVTAASHGELIAASIAGARLVTLPAVHLSNVEF
PQAFEGAVLSFLGAA


References
2 more
    Title: Dynamics of Pseudomonas aeruginosa genome evolution
    Mathee K, Narasimhan G, Valdes C, Qiu X, Matewish JM, Koehrsen M, Rokas A, Yandava CN, Engels R and Lory S <10 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 105:3100, 2008 : PubMed

            

    Title: Genomic analysis reveals that Pseudomonas aeruginosa virulence is combinatorial
    Lee DG, Urbach JM, Wu G, Liberati NT, Feinbaum RL, Miyata S, Diggins LT, He J, Saucier M and Ausubel FM <7 more author(s)>
    Ref: Genome Biol, 7:R90, 2006 : PubMed

            

    Title: Complete genome sequence of Pseudomonas aeruginosa PAO1, an opportunistic pathogen
    Stover CK, Pham XQ, Erwin AL, Mizoguchi SD, Warrener P, Hickey MJ, Brinkman FS, Hufnagle WO, Kowalik DJ and Olson MV <21 more author(s)>
    Ref: Nature, 406:959, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer