pseae-llipa

Pseudomonas aeruginosa gene for lactonizing lipase triacylglycerol lipase (EC 3.1.1.3) lip lipA PA2862 PaLipA

Comment

"Other strains: Pseudomonas aeruginosa (strain LESB58\; UCBPP-PA14\; 2192\; PA7\; 39016\; C3719), Pseudomonas sp. 42A2"

Relationship

Family : Bacterial_lip_FamI.1

Block : L

Position in NCBI Life Tree : Pseudomonas aeruginosa

Molecular evidence

No mutation

No kinetic

No disease

Sequence

Peptide

MKKKSLLPLGLAIGLASLAASPLIQASTYTQTKYPIVLAH
GMLGFDNILG VDYWFGIPSALRRDGAQVYVTEVSQLDTS
EVRGEQLLQQVEEIVALSGQP KVNLIGHSHGGPTIRYVA
AVRPDLIASATSVGAPHKGSDTADFLRQIPPG SAGEAVL
SGLVNSLGALISFLSSGSTGTQNSLGSLESLNSEGAARFN
AKY PQGIPTSACGEGAYKVNGVSYYSWSGSSPLTNFLDP
SDAFLGASSLTFKN GTANDGLVGTCSSHLGMVIRDNYRM
NHLDEVNQVFGLTSLFETSPVSVYR QHANRLKNASL

References

Title : The Membrane-Integrated Steric Chaperone Lif Facilitates Active Site Opening of Pseudomonas aeruginosa Lipase A - Verma_2020_J.Comput.Chem_41_500
Author(s) : Verma N , Dollinger P , Kovacic F , Jaeger KE , Gohlke H
Ref : J Comput Chem , 41 :500 , 2020
Abstract : Verma_2020_J.Comput.Chem_41_500
ESTHER : Verma_2020_J.Comput.Chem_41_500
PubMedSearch : Verma_2020_J.Comput.Chem_41_500
PubMedID: 31618459
Gene_locus related to this paper: pseae-llipa

Title : Structural and dynamic insights revealing how lipase binding domain MD1 of Pseudomonas aeruginosa foldase affects lipase activation - Viegas_2020_Sci.Rep_10_3578
Author(s) : Viegas A , Dollinger P , Verma N , Kubiak J , Viennet T , Seidel CAM , Gohlke H , Etzkorn M , Kovacic F , Jaeger KE
Ref : Sci Rep , 10 :3578 , 2020
Abstract : Viegas_2020_Sci.Rep_10_3578
ESTHER : Viegas_2020_Sci.Rep_10_3578
PubMedSearch : Viegas_2020_Sci.Rep_10_3578
PubMedID: 32107397
Gene_locus related to this paper: pseae-llipa

Title : Understanding domain movements and interactions of Pseudomonas aeruginosa lipase with lipid molecule tristearoyl glycerol: A molecular dynamics approach - Thiruvengadam_2018_J.Mol.Graph.Model_85_190
Author(s) : Thiruvengadam K , Baskaran SK , Pennathur G
Ref : J Mol Graph Model , 85 :190 , 2018
Abstract : Thiruvengadam_2018_J.Mol.Graph.Model_85_190
ESTHER : Thiruvengadam_2018_J.Mol.Graph.Model_85_190
PubMedSearch : Thiruvengadam_2018_J.Mol.Graph.Model_85_190
PubMedID: 30227364
Gene_locus related to this paper: pseae-llipa

Title : Pressure-induced conformational switch of an interfacial protein - Johnson_2016_Proteins_84_820
Author(s) : Johnson QR , Lindsay RJ , Nellas RB , Shen T
Ref : Proteins , 84 :820 , 2016
Abstract : Johnson_2016_Proteins_84_820
ESTHER : Johnson_2016_Proteins_84_820
PubMedSearch : Johnson_2016_Proteins_84_820
PubMedID: 26967808
Gene_locus related to this paper: pseae-llipa

Title : Solvent-Dependent Gating Motions of an Extremophilic Lipase from Pseudomonas aeruginosa - Johnson_2012_Biochemistry_51_6238
Author(s) : Johnson QR , Nellas RB , Shen T
Ref : Biochemistry , 51 :6238 , 2012
Abstract : Johnson_2012_Biochemistry_51_6238
ESTHER : Johnson_2012_Biochemistry_51_6238
PubMedSearch : Johnson_2012_Biochemistry_51_6238
PubMedID: 22830585
Gene_locus related to this paper: pseae-llipa

Title : In vivo functional expression of a screened P. aeruginosa chaperone-dependent lipase in E. coli - Wu_2012_BMC.Biotechnol_12_58
Author(s) : Wu X , You P , Su E , Xu J , Gao B , Wei D
Ref : BMC Biotechnol , 12 :58 , 2012
Abstract : Wu_2012_BMC.Biotechnol_12_58
ESTHER : Wu_2012_BMC.Biotechnol_12_58
PubMedSearch : Wu_2012_BMC.Biotechnol_12_58
PubMedID: 22950599
Gene_locus related to this paper: pseae-llipa

Title : Genetic characterization indicates that a specific subpopulation of Pseudomonas aeruginosa is associated with keratitis infections - Stewart_2011_J.Clin.Microbiol_49_993
Author(s) : Stewart RM , Wiehlmann L , Ashelford KE , Preston SJ , Frimmersdorf E , Campbell BJ , Neal TJ , Hall N , Tuft S , Kaye SB , Winstanley C
Ref : J Clin Microbiol , 49 :993 , 2011
Abstract : Stewart_2011_J.Clin.Microbiol_49_993
ESTHER : Stewart_2011_J.Clin.Microbiol_49_993
PubMedSearch : Stewart_2011_J.Clin.Microbiol_49_993
PubMedID: 21227987
Gene_locus related to this paper: pseae-a3kt39 , pseae-clipa , pseae-llipa , pseae-PA0201 , pseae-PA0231 , pseae-PA0308 , pseae-PA0368 , pseae-PA0480 , pseae-PA0543 , pseae-PA0599 , pseae-PA1166 , pseae-PA1239 , pseae-PA1304 , pseae-PA1510 , pseae-PA1558 , pseae-PA1597 , pseae-PA2098 , pseae-PA2302 , pseae-PA2425 , pseae-PA2540 , pseae-PA2682 , pseae-PA2927 , pseae-PA2949 , pseae-PA3301 , pseae-PA3327 , pseae-PA3695 , pseae-PA3859 , pseae-PA4968 , pseae-PA5080 , pseae-PCHC , pseae-PCHF , pseae-PHAC2 , pseae-phaD , pseae-Q8G8C7 , pseae-Q8G8T6 , pseae-q9i252

Title : Revisiting the lipase from Pseudomonas aeruginosa: directed evolution of substrate acceptance and enantioselectivity using iterative saturation mutagenesis - Prasad_2011_Chemphyschem_12_1550
Author(s) : Prasad S , Bocola M , Reetz MT
Ref : Chemphyschem , 12 :1550 , 2011
Abstract : Prasad_2011_Chemphyschem_12_1550
ESTHER : Prasad_2011_Chemphyschem_12_1550
PubMedSearch : Prasad_2011_Chemphyschem_12_1550
PubMedID: 21472964
Gene_locus related to this paper: pseae-llipa

Title : Differential behaviour of Pseudomonas sp. 42A2 LipC, a lipase showing greater versatility than its counterpart LipA - Bofill_2010_Biochimie_92_307
Author(s) : Bofill C , Prim N , Mormeneo M , Manresa A , Pastor FI , Diaz P
Ref : Biochimie , 92 :307 , 2010
Abstract : Bofill_2010_Biochimie_92_307
ESTHER : Bofill_2010_Biochimie_92_307
PubMedSearch : Bofill_2010_Biochimie_92_307
PubMedID: 19944735
Gene_locus related to this paper: pseae-clipa , pseae-llipa

Title : Co-expression of the lipase and foldase of Pseudomonas aeruginosa to a functional lipase in Escherichia coli - Madan_2010_Appl.Microbiol.Biotechnol_85_597
Author(s) : Madan B , Mishra P
Ref : Applied Microbiology & Biotechnology , 85 :597 , 2010
Abstract : Madan_2010_Appl.Microbiol.Biotechnol_85_597
ESTHER : Madan_2010_Appl.Microbiol.Biotechnol_85_597
PubMedSearch : Madan_2010_Appl.Microbiol.Biotechnol_85_597
PubMedID: 19629472
Gene_locus related to this paper: pseae-llipa

Title : Mutations towards enantioselectivity adversely affect secretion of Pseudomonas aeruginosa lipase - Hausmann_2008_FEMS.Microbiol.Lett_282_65
Author(s) : Hausmann S , Wilhelm S , Jaeger KE , Rosenau F
Ref : FEMS Microbiology Letters , 282 :65 , 2008
Abstract : Hausmann_2008_FEMS.Microbiol.Lett_282_65
ESTHER : Hausmann_2008_FEMS.Microbiol.Lett_282_65
PubMedSearch : Hausmann_2008_FEMS.Microbiol.Lett_282_65
PubMedID: 18355276
Gene_locus related to this paper: pseae-llipa

Title : Cloning and expression of gene, and activation of an organic solvent-stable lipase from Pseudomonas aeruginosa LST-03 - Ogino_2007_Extremophiles_11_809
Author(s) : Ogino H , Katou Y , Akagi R , Mimitsuka T , Hiroshima S , Gemba Y , Doukyu N , Yasuda M , Ishimi K , Ishikawa H
Ref : Extremophiles , 11 :809 , 2007
Abstract : Ogino_2007_Extremophiles_11_809
ESTHER : Ogino_2007_Extremophiles_11_809
PubMedSearch : Ogino_2007_Extremophiles_11_809
PubMedID: 17657406
Gene_locus related to this paper: pseae-llipa

Title : Activation Mechanisms for Pseudomonas species Lipase by Cardiovascular Drugs in Vitro - Lin_2007_J.Chin.Chem.Soc_54_1601
Author(s) : Lin MC , Lai GW , Lin CS , Lin G
Ref : Journal of the Chinese Chemical Society , 54 :1601 , 2007
Abstract : Lin_2007_J.Chin.Chem.Soc_54_1601
ESTHER : Lin_2007_J.Chin.Chem.Soc_54_1601
PubMedSearch : Lin_2007_J.Chin.Chem.Soc_54_1601
PubMedID:
Gene_locus related to this paper: pseae-llipa

Title : Expanding the substrate scope of enzymes: combining mutations obtained by CASTing - Reetz_2006_Chemistry_12_6031
Author(s) : Reetz MT , Carballeira JD , Peyralans J , Hobenreich H , Maichele A , Vogel A
Ref : Chemistry , 12 :6031 , 2006
Abstract : Reetz_2006_Chemistry_12_6031
ESTHER : Reetz_2006_Chemistry_12_6031
PubMedSearch : Reetz_2006_Chemistry_12_6031
PubMedID: 16789057
Gene_locus related to this paper: pseae-llipa

Title : Directed evolution of Pseudomonas aeruginosa lipase for improved amide-hydrolyzing activity - Fujii_2005_Protein.Eng.Des.Sel_18_93
Author(s) : Fujii R , Nakagawa Y , Hiratake J , Sogabe A , Sakata K
Ref : Protein Engineering Des Sel , 18 :93 , 2005
Abstract : Fujii_2005_Protein.Eng.Des.Sel_18_93
ESTHER : Fujii_2005_Protein.Eng.Des.Sel_18_93
PubMedSearch : Fujii_2005_Protein.Eng.Des.Sel_18_93
PubMedID: 15788423
Gene_locus related to this paper: pseae-llipa

Title : Expanding the range of substrate acceptance of enzymes: combinatorial active-site saturation test - Reetz_2005_Angew.Chem.Int.Ed.Engl_44_4192
Author(s) : Reetz MT , Bocola M , Carballeira JD , Zha D , Vogel A
Ref : Angew Chem Int Ed Engl , 44 :4192 , 2005
Abstract : Reetz_2005_Angew.Chem.Int.Ed.Engl_44_4192
ESTHER : Reetz_2005_Angew.Chem.Int.Ed.Engl_44_4192
PubMedSearch : Reetz_2005_Angew.Chem.Int.Ed.Engl_44_4192
PubMedID: 15929154
Gene_locus related to this paper: pseae-llipa

Title : Learning from directed evolution: theoretical investigations into cooperative mutations in lipase enantioselectivity - Bocola_2004_Chembiochem_5_214
Author(s) : Bocola M , Otte N , Jaeger KE , Reetz MT , Thiel W
Ref : Chembiochem , 5 :214 , 2004
Abstract : Bocola_2004_Chembiochem_5_214
ESTHER : Bocola_2004_Chembiochem_5_214
PubMedSearch : Bocola_2004_Chembiochem_5_214
PubMedID: 14760743
Gene_locus related to this paper: pseae-llipa

Title : Controlling the enantioselectivity of enzymes by directed evolution: practical and theoretical ramifications - Reetz_2004_Proc.Natl.Acad.Sci.U.S.A_101_5716
Author(s) : Reetz MT
Ref : Proc Natl Acad Sci U S A , 101 :5716 , 2004
Abstract : Reetz_2004_Proc.Natl.Acad.Sci.U.S.A_101_5716
ESTHER : Reetz_2004_Proc.Natl.Acad.Sci.U.S.A_101_5716
PubMedSearch : Reetz_2004_Proc.Natl.Acad.Sci.U.S.A_101_5716
PubMedID: 15079053
Gene_locus related to this paper: pseae-llipa

Title : Characterization of the lipA gene encoding the major lipase from Pseudomonas aeruginosa strain IGB83 - Martinez_2001_Appl.Microbiol.Biotechnol_56_731
Author(s) : Martinez A , Soberon-Chavez G
Ref : Applied Microbiology & Biotechnology , 56 :731 , 2001
Abstract : Martinez_2001_Appl.Microbiol.Biotechnol_56_731
ESTHER : Martinez_2001_Appl.Microbiol.Biotechnol_56_731
PubMedSearch : Martinez_2001_Appl.Microbiol.Biotechnol_56_731
PubMedID: 11601622
Gene_locus related to this paper: pseae-llipa

Title : Disulfide bond in Pseudomonas aeruginosa lipase stabilizes the structure but is not required for interaction with its foldase - Liebeton_2001_J.Bacteriol_183_597
Author(s) : Liebeton K , Zacharias A , Jaeger KE
Ref : Journal of Bacteriology , 183 :597 , 2001
Abstract : Liebeton_2001_J.Bacteriol_183_597
ESTHER : Liebeton_2001_J.Bacteriol_183_597
PubMedSearch : Liebeton_2001_J.Bacteriol_183_597
PubMedID: 11133953
Gene_locus related to this paper: pseae-llipa

Title : Crystal structure of pseudomonas aeruginosa lipase in the open conformation. The prototype for family I.1 of bacterial lipases - Nardini_2000_J.Biol.Chem_275_31219
Author(s) : Nardini M , Lang DA , Liebeton K , Jaeger KE , Dijkstra BW
Ref : Journal of Biological Chemistry , 275 :31219 , 2000
Abstract : Nardini_2000_J.Biol.Chem_275_31219
ESTHER : Nardini_2000_J.Biol.Chem_275_31219
PubMedSearch : Nardini_2000_J.Biol.Chem_275_31219
PubMedID: 10893416
Gene_locus related to this paper: pseae-llipa

Title : Substitutions of Ser for Asn-163 and Pro for Leu-264 are important for stabilization of lipase from Pseudomonas aeruginosa - Shinkai_1996_J.Biochem_120_915
Author(s) : Shinkai A , Hirano A , Aisaka K
Ref : J Biochem , 120 :915 , 1996
Abstract : Shinkai_1996_J.Biochem_120_915
ESTHER : Shinkai_1996_J.Biochem_120_915
PubMedSearch : Shinkai_1996_J.Biochem_120_915
PubMedID: 8982856
Gene_locus related to this paper: pseae-llipa

Title : Molecular genetics of the extracellular lipase of Pseudomonas aeruginosa PAO1 - Wohlfarth_1992_J.Gen.Microbiol_138_1325
Author(s) : Wohlfarth S , Hoesche C , Strunk C , Winkler UK
Ref : J Gen Microbiol , 138 :1325 , 1992
Abstract : Wohlfarth_1992_J.Gen.Microbiol_138_1325
ESTHER : Wohlfarth_1992_J.Gen.Microbiol_138_1325
PubMedSearch : Wohlfarth_1992_J.Gen.Microbiol_138_1325
PubMedID: 1512563
Gene_locus related to this paper: pseae-llipa

Title : Extracellular lipase from Pseudomonas aeruginosa is an amphiphilic protein - Jaeger_1992_Biochim.Biophys.Acta_1120_315
Author(s) : Jaeger KE , Adrian FJ , Meyer HE , Hancock RE , Winkler UK
Ref : Biochimica & Biophysica Acta , 1120 :315 , 1992
Abstract : Jaeger_1992_Biochim.Biophys.Acta_1120_315
ESTHER : Jaeger_1992_Biochim.Biophys.Acta_1120_315
PubMedSearch : Jaeger_1992_Biochim.Biophys.Acta_1120_315
PubMedID: 1576157
Gene_locus related to this paper: pseae-llipa

Title : Purification, molecular cloning, and expression of lipase from Pseudomonas aeruginosa - Chihara-Siomi_1992_Arch.Biochem.Biophys_296_505
Author(s) : Chihara-Siomi M , Yoshikawa K , Oshima-Hirayama N , Yamamoto K , Sogabe Y , Nakatani T , Nishioka T , Oda J
Ref : Archives of Biochemistry & Biophysics , 296 :505 , 1992
Abstract : Chihara-Siomi_1992_Arch.Biochem.Biophys_296_505
ESTHER : Chihara-Siomi_1992_Arch.Biochem.Biophys_296_505
PubMedSearch : Chihara-Siomi_1992_Arch.Biochem.Biophys_296_505
PubMedID: 1632642
Gene_locus related to this paper: pseae-llipa

Title : Purification and properties of extracellular lipase from Pseudomonas aeruginosa EF2 - Gilbert_1991_J.Gen.Microbiol_137_2223
Author(s) : Gilbert EJ , Cornish A , Jones CW
Ref : J Gen Microbiol , 137 :2223 , 1991
Abstract : Gilbert_1991_J.Gen.Microbiol_137_2223
ESTHER : Gilbert_1991_J.Gen.Microbiol_137_2223
PubMedSearch : Gilbert_1991_J.Gen.Microbiol_137_2223
PubMedID: 1748875
Gene_locus related to this paper: pseae-llipa

Title : Extracellular lipase of Pseudomonas aeruginosa: biochemical characterization and effect on human neutrophil and monocyte function in vitro - Jaeger_1991_Microb.Pathog_10_173
Author(s) : Jaeger KE , Kharazmi A , Hoiby N
Ref : Microb Pathog , 10 :173 , 1991
Abstract : Jaeger_1991_Microb.Pathog_10_173
ESTHER : Jaeger_1991_Microb.Pathog_10_173
PubMedSearch : Jaeger_1991_Microb.Pathog_10_173
PubMedID: 1910141
Gene_locus related to this paper: pseae-llipa