Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: salty-STY2428

Salmonella typhi, Salmonella paratyphi, S. enterica, S. gallinarum, S. enteritidis, S. arizonae, S. heidelberg, S. agona, S. typhimurium, S. dublin putative esterase yeiG

Comment
There are more than 800 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|A85-EsteraseD-FGH
Block| X
Position in NCBI Life Tree|Salmonella typhi
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Salmonella: N E > Salmonella enterica: N E > Salmonella enterica subsp. enterica: N E > Salmonella enterica subsp. enterica serovar Typhi: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: salty-STY2428
Colored MSA for A85-EsteraseD-FGH (raw)
MEMLEEHRCFGGWQQRWRHHAATLNCAMTFSIFLPPTQDNEPPPVLYWLS
GLTCNDENFTTKAGAQRIAAELGIVLVMPDTSPRGEQVADDSGYDLGHGA
GFYLNATQPPWASHYRMYDYLRDELPALIQTQFNVSDRCAISGHSMGGHG
ALIMALKNPGKYTSISAFAPIVNPSRVPWGIKALTAYLGEDESAWTEWDS
CELMLASQPQDAIPVLIDQGDSDQFLADQLQPAVLAEAARQTAWPMTLRI
QPGYDHSYYFIASFIEDHLRFHARYLRDEHETSPT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEMLEEHRCFGGWQQRWRHHAATLNCAMTFSIFLPPTQDNEPPPVLYWLS
GLTCNDENFTTKAGAQRIAAELGIVLVMPDTSPRGEQVADDSGYDLGHGA
GFYLNATQPPWASHYRMYDYLRDELPALIQTQFNVSDRCAISGHSMGGHG
ALIMALKNPGKYTSISAFAPIVNPSRVPWGIKALTAYLGEDESAWTEWDS
CELMLASQPQDAIPVLIDQGDSDQFLADQLQPAVLAEAARQTAWPMTLRI
QPGYDHSYYFIASFIEDHLRFHARYLRDEHETSPT


References
4 more
    Title: Comparative genome analysis of Salmonella Enteritidis PT4 and Salmonella Gallinarum 287/91 provides insights into evolutionary and host adaptation pathways
    Thomson NR, Clayton DJ, Windhorst D, Vernikos G, Davidson S, Churcher C, Quail MA, Stevens M, Jones MA and Parkhill J <28 more author(s)>
    Ref: Genome Res, 18:1624, 2008 : PubMed

            

    Title: Comparison of genome degradation in Paratyphi A and Typhi, human-restricted serovars of Salmonella enterica that cause typhoid
    McClelland M, Sanderson KE, Clifton SW, Latreille P, Porwollik S, Sabo A, Meyer R, Bieri T, Ozersky P and Wilson RK <25 more author(s)>
    Ref: Nat Genet, 36:1268, 2004 : PubMed

            

    Title: Complete genome sequence of a multiple drug resistant Salmonella enterica serovar Typhi CT18
    Parkhill J, Dougan G, James KD, Thomson NR, Pickard D, Wain J, Churcher C, Mungall KL, Bentley SD and Barrell BG <31 more author(s)>
    Ref: Nature, 413:848, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer