Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: solue-q02aa4

Solibacter usitatus (strain Ellin6076) Putative uncharacterized protein

Relationship
Family|ABHD18
Block| X
Position in NCBI Life Tree|Solibacter usitatus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Acidobacteria: N E > Solibacteres: N E > Solibacterales: N E > Solibacteraceae: N E > Candidatus Solibacter: N E > Candidatus Solibacter usitatus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000473
1 UniProt : Q02AA4
1 UniProt : Q02AA4
1 Interpro : Q02AA4
1 Pfam : Q02AA4
1 PIRSF : Q02AA4
1 SUPERFAM : Q02AA4
Sequence
Graphical view for this peptide sequence: solue-q02aa4
Colored MSA for ABHD18 (raw)
MKGPYAHWMERWEHKLATRDTNRVVRPFDWGGDWLNSLEFPGFPSDANGN
TADCLSEFVSRALADSDRFFSYAPVRDYRLDEENRLTFTSPVRTRHPENN
TTHALWFPTPNDQGRVVIVLPQWNSGPDGHVGLAKLLNRFGVSALRMTMA
YHAERKPAETARADYHVSSNVGRTIHAGRQSVLDVRACVDWLERKGYSRI
GVLGTSLGSCVAFISAAHEPRIRMGIFNHVSMNFADVVWTGLSTQNVRQG
FTGNVSLEELRRYWSLISPSAYLHRLKGRELKTLLIWASHDSTFLPVYSR
QVLDRFRELELPHSVFNLPCGHYTTGQFPFNLIDGVAMCRFAARNL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKGPYAHWMERWEHKLATRDTNRVVRPFDWGGDWLNSLEFPGFPSDANGN
TADCLSEFVSRALADSDRFFSYAPVRDYRLDEENRLTFTSPVRTRHPENN
TTHALWFPTPNDQGRVVIVLPQWNSGPDGHVGLAKLLNRFGVSALRMTMA
YHAERKPAETARADYHVSSNVGRTIHAGRQSVLDVRACVDWLERKGYSRI
GVLGTSLGSCVAFISAAHEPRIRMGIFNHVSMNFADVVWTGLSTQNVRQG
FTGNVSLEELRRYWSLISPSAYLHRLKGRELKTLLIWASHDSTFLPVYSR
QVLDRFRELELPHSVFNLPCGHYTTGQFPFNLIDGVAMCRFAARNL


Reference
    Title: Three genomes from the phylum Acidobacteria provide insight into the lifestyles of these microorganisms in soils
    Ward NL, Challacombe JF, Janssen PH, Henrissat B, Coutinho PM, Wu M, Xie G, Haft DH, Sait M and Kuske CR <36 more author(s)>
    Ref: Applied Environmental Microbiology, 75:2046, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer