Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strag-q3dah6

Streptococcus agalactiae, hypothetical protein

Comment
Other strains: Streptococcus agalactiae (COH1; H36B)


Relationship
Family|Mbeg1-like
Block| X
Position in NCBI Life Tree|Streptococcus agalactiae COH1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Streptococcaceae: N E > Streptococcus: N E > Streptococcus agalactiae: N E > Streptococcus agalactiae COH1: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: strag-q3dah6
Colored MSA for Mbeg1-like (raw)
MSEYKTIHPNARLKDQYDNTIGVVSEVYDNTSHSGEQIYAVVDNRHIPKE
DVKEVTVLFRGSTSPQEFINNPADVTLDWLENDIPMASNIWVMKDFGNPH
NFSAVSPQLKASSEHLKEIMKKYPNAKINIGGHSLGGMDAQYAVVDITDK
KDLKRINSVHVYNAPDIYPTLTKGQKKTADSLKSKIVVYVDPNDFIGMVG
REGKKGSEDSVGTVYYTESPDINWIDQHMTYGYRMENGQIKVIETNLPPE
VRTTRKAMGSFYKDKKKFKKSGKGLSSHEKIFLDAEQAAVIASGLVSTAE
TALEDIKTSAKTAVGEAEELWNTTKSIPFGITELTEAELAEAYAEGGVTY
DSIVTKTDTHFDEKVKNAGDLVTTYTTLKSDIQSGVETMLSKDSELAGDF
KAWEN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSEYKTIHPNARLKDQYDNTIGVVSEVYDNTSHSGEQIYAVVDNRHIPKE
DVKEVTVLFRGSTSPQEFINNPADVTLDWLENDIPMASNIWVMKDFGNPH
NFSAVSPQLKASSEHLKEIMKKYPNAKINIGGHSLGGMDAQYAVVDITDK
KDLKRINSVHVYNAPDIYPTLTKGQKKTADSLKSKIVVYVDPNDFIGMVG
REGKKGSEDSVGTVYYTESPDINWIDQHMTYGYRMENGQIKVIETNLPPE
VRTTRKAMGSFYKDKKKFKKSGKGLSSHEKIFLDAEQAAVIASGLVSTAE
TALEDIKTSAKTAVGEAEELWNTTKSIPFGITELTEAELAEAYAEGGVTY
DSIVTKTDTHFDEKVKNAGDLVTTYTTLKSDIQSGVETMLSKDSELAGDF
KAWEN


Reference
    Title: Genome analysis of multiple pathogenic isolates of Streptococcus agalactiae: implications for the microbial pan-genome
    Tettelin H, Masignani V, Cieslewicz MJ, Donati C, Medini D, Ward NL, Angiuoli SV, Crabtree J, Jones AL and Fraser CM <36 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 102:13950, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer