strag-SAG0383

Streptococcus agalactiae, protein of unknown function/lipoprotein, putative

Comment

"Other strains: Streptococcus agalactiae (serotype V (strain ATCC BAA-611 \/ 2603 V\/R)\; ATCC 13813\; serotype III (strain NEM316)\; H36B\; COH1\; CJB111\; 515\; 18RS21\; serotype Ia)" || "Q8E1H1 is for serotype V Q8E6Y9 for serotype III"

Relationship

Family : Hormone-sensitive_lipase_like

Block : H

Position in NCBI Life Tree : Streptococcus agalactiae

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MKPSFKKLLLLFSIITILSIACTPHAKASGRSWKSWFIEQ
YFWLKRDKSY YKVQDESSFQKYLNASREQSDKGYYLDPN
SVNGGLVQERLFDMQVYSWND NGKANQKTIFYLAGGSYL
NNPTPYHISMLKTLSTSLDAKIILPIYPKTPR YTYDYAI
PRLVNLYRHFHEKNANLTLMGDSAGGGLALGLAHALSHQS
GQE AIPQPKNIILLSPWLDVTMKHPEIPKYEDTDPILSA
WGLARVGEIWANGS NNTNHTYVSPKNAPATKLAPITLFT
GTREIFFPDIRDYAAQLQAANHPVN YIAQEGMNHVYPIY
PIEEAKTAQYQMIDIINKTP

References

Title : Complete genome sequence and comparative genomic analysis of an emerging human pathogen, serotype V Streptococcus agalactiae - Tettelin_2002_Proc.Natl.Acad.Sci.U.S.A_99_12391
Author(s) : Tettelin H , Masignani V , Cieslewicz MJ , Eisen JA , Peterson S , Wessels MR , Paulsen IT , Nelson KE , Margarit I , Read TD , Madoff LC , Wolf AM , Beanan MJ , Brinkac LM , Daugherty SC , DeBoy RT , Durkin AS , Kolonay JF , Madupu R , Lewis MR , Radune D , Fedorova NB , Scanlan D , Khouri H , Mulligan S , Carty HA , Cline RT , Van Aken SE , Gill J , Scarselli M , Mora M , Iacobini ET , Brettoni C , Galli G , Mariani M , Vegni F , Maione D , Rinaudo D , Rappuoli R , Telford JL , Kasper DL , Grandi G , Fraser CM
Ref : Proc Natl Acad Sci U S A , 99 :12391 , 2002
Abstract : Tettelin_2002_Proc.Natl.Acad.Sci.U.S.A_99_12391
ESTHER : Tettelin_2002_Proc.Natl.Acad.Sci.U.S.A_99_12391
PubMedSearch : Tettelin_2002_Proc.Natl.Acad.Sci.U.S.A_99_12391
PubMedID: 12200547
Gene_locus related to this paper: strag-ESTA , strag-GBS0040 , strag-GBS1828 , strag-pepx , strag-SAG0108 , strag-SAG0246 , strag-SAG0383 , strag-SAG0521 , strag-SAG0679 , strag-SAG0680 , strag-SAG0681 , strag-SAG0785 , strag-SAG0912 , strag-SAG1040 , strag-SAG1562 , strag-SAG2132

Title : Genome sequence of Streptococcus agalactiae, a pathogen causing invasive neonatal disease - Glaser_2002_Mol.Microbiol_45_1499
Author(s) : Glaser P , Rusniok C , Buchrieser C , Chevalier F , Frangeul L , Msadek T , Zouine M , Couve E , Lalioui L , Poyart C , Trieu-Cuot P , Kunst F
Ref : Molecular Microbiology , 45 :1499 , 2002
Abstract : Glaser_2002_Mol.Microbiol_45_1499
ESTHER : Glaser_2002_Mol.Microbiol_45_1499
PubMedSearch : Glaser_2002_Mol.Microbiol_45_1499
PubMedID: 12354221
Gene_locus related to this paper: strag-ESTA , strag-GBS0040 , strag-GBS0107 , strag-GBS0567 , strag-GBS1828 , strag-GBS1967 , strag-pepx , strag-SAG0383 , strag-SAG0785 , strag-SAG0912 , strag-SAG1040 , strag-SAG1562 , strag-SAG2132