Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strsw-c9zcr8

Streptomyces scabies (Streptomyces scabiei) secreted esterase sub1 ScSub1

Comment
Other strains: Streptomyces scabies (strain 87.22) Best pNP substrate pNP-C4 Paranitrophenylbutyrate


Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Streptomyces scabies
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces scabiei: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
Paranitrophenylbutyrate
No inhibitor
3 Genbank : FN554889, QEX94755, mk689853
2 UniProt : C9ZCR8, A0A5P3LVN0
2 UniProt : C9ZCR8, A0A5P3LVN0
2 Interpro : C9ZCR8, A0A5P3LVN0
2 Prodom : C9ZCR8, A0A5P3LVN0
2 Pfam : C9ZCR8, A0A5P3LVN0
2 PIRSF : C9ZCR8, A0A5P3LVN0
2 SUPERFAM : C9ZCR8, A0A5P3LVN0
Sequence
Graphical view for this peptide sequence: strsw-c9zcr8
Colored MSA for Cutinase (raw)
MRIRLYLAAIPLVGGAGLAAVATPTATAAACTDIDVVSARGTFEPGTLGF
IVGDPVYAALQKKVAGKSLSSYKVNYPADLSPTSAAQGNADLVNHVRSQA
ASCPNQRFVLVGYSQGANVVDNSIGISSAGAVVGSPIVATLPAALEPRVS
AVLLFGNPIRAIGKSVTGTYQSRTIDFCAAGDPVCENGGGDVGAHLGYRA
NADAAAAFAATKI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRIRLYLAAIPLVGGAGLAAVATPTATAAACTDIDVVSARGTFEPGTLGF
IVGDPVYAALQKKVAGKSLSSYKVNYPADLSPTSAAQGNADLVNHVRSQA
ASCPNQRFVLVGYSQGANVVDNSIGISSAGAVVGSPIVATLPAALEPRVS
AVLLFGNPIRAIGKSVTGTYQSRTIDFCAAGDPVCENGGGDVGAHLGYRA
NADAAAAFAATKI


References
1 more
    Title: Phylogenetic analysis and in-depth characterization of functionally and structurally diverse CE5 cutinases
    Novy V, Carneiro LV, Shin JH, Larsbrink J, Olsson L
    Ref: Journal of Biological Chemistry, :101302, 2021 : PubMed

            

    Title: Enzymatic Degradation of p-Nitrophenyl Esters, Polyethylene Terephthalate, Cutin, and Suberin by Sub1, a Suberinase Encoded by the Plant Pathogen Streptomyces scabies
    Jabloune R, Khalil M, Ben Moussa IE, Simao-Beaunoir AM, Lerat S, Brzezinski R, Beaulieu C
    Ref: Microbes Environ, 35:, 2020 : PubMed

            

    Title: Streptomyces scabies 87-22 contains a coronafacic acid-like biosynthetic cluster that contributes to plant-microbe interactions
    Bignell DR, Seipke RF, Huguet-Tapia JC, Chambers AH, Parry RJ, Loria R
    Ref: Mol Plant Microbe Interact, 23:161, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer