takru-nlgn2a

 
Takifugu rubripes (Japanese pufferfish) (Fugu rubripes) Neuroligin 2a

Comment
SINFRUG00000025588 SINFRUP00000025588 SINFRUG00000076627 SINFRUP00000078547


Relationship
Family Neuroligin
Block C
Takifugu rubripes position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Actinopterygii: N E > Actinopteri: N E > Neopterygii: N E > Teleostei: N E > Osteoglossocephalai: N E > Clupeocephala: N E > Euteleosteomorpha: N E > Neoteleostei: N E > Eurypterygia: N E > Ctenosquamata: N E > Acanthomorphata: N E > Euacanthomorphacea: N E > Percomorphaceae: N E > Eupercaria: N E > Tetraodontiformes: N E > Tetraodontoidei: N E > Tetradontoidea: N E > Tetraodontidae: N E > Takifugu: N E > Takifugu rubripes: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



1 Genbank : GQ489198
2 UniProt : D2X2G7, H2SY03
>3 UniProtTrembl links 3 more: D2X2G7, H2SY03, A0A6D2XAX4
>3 Interpro links 3 more: D2X2G7, H2SY03, A0A6D2XAX4
>3 Prodom links 3 more: D2X2G7, H2SY03, A0A6D2XAX4
>3 Pfam links 3 more: D2X2G7, H2SY03, A0A6D2XAX4
>3 PIRSF links 3 more: D2X2G7, H2SY03, A0A6D2XAX4
>3 SUPERFAM links 3 more: D2X2G7, H2SY03, A0A6D2XAX4
>3 QuickSwissBlast links 3 more: D2X2G7, H2SY03, A0A6D2XAX4
 
Sequence
Graphical view for this peptide sequence: takru-nlgn2a
Colored MSA for Neuroligin (raw)
MTKTAFILDMIFPLNAASHQGYGGKRHSQIANCCLQLLLGLVLHLTLSSC
QRVDLKHPIVSTVYGKVRGIRRELNNEILAPVEQYLGVPYATAPIGERRF
QPPEAPGSWQEIRNATQFASVCPQNVHGVLPEIMLPVWFTDNLDAAATFV
QNQSEDCLYLNIYVPTEDGPLTKKQESTMNRPKDEDIRDRRKKPVMLFIH
GGSFMEGSGNMFDGGVLAAYGNVIVVTMNYRLGVLGFLSTGDQSAKGNYG
LLDQIQALRWLKENIGHFGGDPERITIFGSGAGAACVNLLILSHHSEGLF
QRAIAQSGSALSSWAVNYQPVMYTKILAKKVGCSLGDMAELVECLRRKTF
RELVDQDIQPARYHIAFGPVVDGDVVPDDPEILMQQGEFLNYDMLLGVNQ
GEGLKFVDDSEGEDGISAASFDYTISNFVDNLYGYPDAKDILRETIKFMY
TDWADRDNSDMRRKTLLALFTDHQWVAPAVATAKLHAEFQSPVFFYTFHH
HCQTEARPEWADAAHGDEIPYVFGIPMMGATELFPCNFSKNDVMLSAVVM
TYWTNFAKTGDPNLPVPQDTTFIHTKPNRFEEVIWTKFSSKDKQYLHIGL
KPRVRDNYRANKVAFWLELVPHLHGLHKVISPITTNLPPVGTNRWKGQQT
PGTRPTRNPVISTYPPDPEPEDSERPTYLPFPRKTRDYSTELSVTVAVGA
SLLFLNVLAFAALYYKRDKRHELMQRRHRRLSPQRGTTMGMGVGMGVVGA
PPHNDLALSQEEELMSLQIKQQRVELEHGTPLPSRGVHGDLEPLRPPVCP
PDYTLALRRAPEDVPLMTANTITMIPSTISGMQSLHPFNTYPPVPTPSTT
PVPSHSNNALPHQHSTTRV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTKTAFILDMIFPLNAASHQGYGGKRHSQIANCCLQLLLGLVLHLTLSSC
QRVDLKHPIVSTVYGKVRGIRRELNNEILAPVEQYLGVPYATAPIGERRF
QPPEAPGSWQEIRNATQFASVCPQNVHGVLPEIMLPVWFTDNLDAAATFV
QNQSEDCLYLNIYVPTEDGPLTKKQESTMNRPKDEDIRDRRKKPVMLFIH
GGSFMEGSGNMFDGGVLAAYGNVIVVTMNYRLGVLGFLSTGDQSAKGNYG
LLDQIQALRWLKENIGHFGGDPERITIFGSGAGAACVNLLILSHHSEGLF
QRAIAQSGSALSSWAVNYQPVMYTKILAKKVGCSLGDMAELVECLRRKTF
RELVDQDIQPARYHIAFGPVVDGDVVPDDPEILMQQGEFLNYDMLLGVNQ
GEGLKFVDDSEGEDGISAASFDYTISNFVDNLYGYPDAKDILRETIKFMY
TDWADRDNSDMRRKTLLALFTDHQWVAPAVATAKLHAEFQSPVFFYTFHH
HCQTEARPEWADAAHGDEIPYVFGIPMMGATELFPCNFSKNDVMLSAVVM
TYWTNFAKTGDPNLPVPQDTTFIHTKPNRFEEVIWTKFSSKDKQYLHIGL
KPRVRDNYRANKVAFWLELVPHLHGLHKVISPITTNLPPVGTNRWKGQQT
PGTRPTRNPVISTYPPDPEPEDSERPTYLPFPRKTRDYSTELSVTVAVGA
SLLFLNVLAFAALYYKRDKRHELMQRRHRRLSPQRGTTMGMGVGMGVVGA
PPHNDLALSQEEELMSLQIKQQRVELEHGTPLPSRGVHGDLEPLRPPVCP
PDYTLALRRAPEDVPLMTANTITMIPSTISGMQSLHPFNTYPPVPTPSTT
PVPSHSNNALPHQHSTTRV

no DNA




References
    Title: Characterization of the neuroligin gene family expression and evolution in zebrafish
    Rissone A, Sangiorgio L, Monopoli M, Beltrame M, Zucchi I, Bussolino F, Arese M, Cotelli F
    Ref: Developmental Dynamics, 239:688, 2010 : PubMed

            

    Title: The medaka draft genome and insights into vertebrate genome evolution
    Kasahara M, Naruse K, Sasaki S, Nakatani Y, Qu W, Ahsan B, Yamada T, Nagayasu Y, Doi K and Kohara Y <28 more author(s)>
    Ref: Nature, 447:714, 2007 : PubMed

            

    Title: Whole-genome shotgun assembly and analysis of the genome of Fugu rubripes
    Aparicio S, Chapman J, Stupka E, Putnam N, Chia JM, Dehal P, Christoffels A, Rash S, Hoon S and Brenner S <31 more author(s)>
    Ref: Science, 297:1301, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer