Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-AIM2

Saccharomyces cerevisiae (Baker's yeast) yae9 hypothetical 27.1 kda protein in acs1-gcv3 intergenic region

Comment
Other strains: Saccharomyces cerevisiae (strain ATCC 204508 / S288c; FostersB; AWRI1631; Lalvin EC1118 / Prise de mousse; YJM789; RM11-1a; Lalvin QA23; Zymaflore VL3; AWRI796; VIN 13; JAY291; FostersO) (Baker's yeast)


Relationship
Family|Dienelactone_hydrolase
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : U12980
>3 UniProt links 3 more: P39721, B5VDH1, C8Z3G2
>3 UniProt links 3 more: P39721, B5VDH1, C8Z3G2
>3 Interpro links 3 more: P39721, B5VDH1, C8Z3G2
>3 Prodom links 3 more: P39721, B5VDH1, C8Z3G2
>3 Pfam links 3 more: P39721, B5VDH1, C8Z3G2
>3 PIRSF links 3 more: P39721, B5VDH1, C8Z3G2
>3 SUPERFAM links 3 more: P39721, B5VDH1, C8Z3G2
1 SGD : S0000047
Sequence
Graphical view for this peptide sequence: yeast-AIM2
Colored MSA for Dienelactone_hydrolase (raw)
MASNQPGKCCFEGVCHDGTPKGRREEIFGLDTYAAGSTSPKEKVIVILTD
VYGNKFNNVLLTADKFASAGYMVFVPDILFGDAISSDKPIDRDAWFQRHS
PEVTKKIVDGFMKLLKLEYDPKFIGVVGYCFGAKFAVQHISGDGGLANAA
AIAHPSFVSIEEIEAIDSKKPILISAAEEDHIFPANLRHLTEEKLKDNHA
TYQLDLFSGVAHGFAARGDISIPAVKYAKEKVLLDQIYWFNHFSNV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASNQPGKCCFEGVCHDGTPKGRREEIFGLDTYAAGSTSPKEKVIVILTD
VYGNKFNNVLLTADKFASAGYMVFVPDILFGDAISSDKPIDRDAWFQRHS
PEVTKKIVDGFMKLLKLEYDPKFIGVVGYCFGAKFAVQHISGDGGLANAA
AIAHPSFVSIEEIEAIDSKKPILISAAEEDHIFPANLRHLTEEKLKDNHA
TYQLDLFSGVAHGFAARGDISIPAVKYAKEKVLLDQIYWFNHFSNV


References
5 more
    Title: Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae
    Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S and LaBaer J <14 more author(s)>
    Ref: Genome Res, 17:536, 2007 : PubMed

            

    Title: Global analysis of protein localization in budding yeast
    Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK
    Ref: Nature, 425:686, 2003 : PubMed

            

    Title: The nucleotide sequence of chromosome I from Saccharomyces cerevisiae
    Bussey H, Kaback DB, Zhong W, Vo DT, Clark MW, Fortin N, Hall J, Ouellette BF, Keng T and et al. <1 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 92:3809, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer