Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-tgl2

Saccharomyces cerevisiae (Baker's yeast) (and strains YJM789; JAY291; AWRI1631; Lalvin EC1118 / Prise de mousse; RM11-1a) lipase 2 (EC 3.1.1.3) (triacylglycerol lipase)

Comment
Warning: Not bacteria


Relationship
Family|PGAP1
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 6 more: X98000, X84162, Z49209
>3 UniProt links 3 more: P54857, A6ZY23, C7GT93
>3 UniProt links 3 more: P54857, A6ZY23, C7GT93
>3 Interpro links 3 more: P54857, A6ZY23, C7GT93
>3 Pfam links 3 more: P54857, A6ZY23, C7GT93
>3 PIRSF links 3 more: P54857, A6ZY23, C7GT93
>3 SUPERFAM links 3 more: P54857, A6ZY23, C7GT93
Sequence
Graphical view for this peptide sequence: yeast-tgl2
Colored MSA for PGAP1 (raw)
MKNDNKANDIIIDSVKVPDSYKPPKNPIVFCHGLSGFDKLILIPSVFHLT
NLISNSIVHNMAENFMQDDEDKSDNKYTNLLEIEYWIGVKKFLQSKGCTV
ITTKVPGFGSIEERAMALDAQLQKEVKKIESKDKRHSLNLIAHSMGGLDC
RYLICNIKNRNYDILSLTTISTPHRGSEMADYVVDLFENLNALRVSQKIL
PICFYQLTTAYMKYFNLVTPNSPKVSYFSYGCSFVPKWYNVFCTPWKIVY
ERSKGCPNDGLVTINSSKWGEYRGTLKDMDHLDVINWKNKLQDDWSKFFR
TTTVGEKVDILNFYLKITDDLARKGF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKNDNKANDIIIDSVKVPDSYKPPKNPIVFCHGLSGFDKLILIPSVFHLT
NLISNSIVHNMAENFMQDDEDKSDNKYTNLLEIEYWIGVKKFLQSKGCTV
ITTKVPGFGSIEERAMALDAQLQKEVKKIESKDKRHSLNLIAHSMGGLDC
RYLICNIKNRNYDILSLTTISTPHRGSEMADYVVDLFENLNALRVSQKIL
PICFYQLTTAYMKYFNLVTPNSPKVSYFSYGCSFVPKWYNVFCTPWKIVY
ERSKGCPNDGLVTINSSKWGEYRGTLKDMDHLDVINWKNKLQDDWSKFFR
TTTVGEKVDILNFYLKITDDLARKGF


References
4 more
    Title: The TGL2 gene of Saccharomyces cerevisiae encodes an active acylglycerol lipase located in the mitochondria
    Ham HJ, Rho HJ, Shin SK, Yoon HJ
    Ref: Journal of Biological Chemistry, 285:3005, 2010 : PubMed

            

    Title: The Saccharomyces cerevisiae TGL2 gene encodes a protein with lipolytic activity and can complement an Escherichia coli diacylglycerol kinase disruptant
    Van Heusden GP, Nebohacova M, Overbeeke TL, Steensma HY
    Ref: Yeast, 14:225, 1998 : PubMed

            

    Title: Nucleotide sequence analysis of a 32,500 bp region of the right arm of Saccharomyces cerevisiae chromosome IV
    Brandt P, Ramlow S, Otto B, Bloecker H
    Ref: Yeast, 12:85, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer