agrtu-ATU2171

Agrobacterium tumefaciens (strain C58 / ATCC 33970) hydrolase

Comment

Relationship

Family : Tiancimycin-TnmK-Tripeptidase-HIP

Block : X

Position in NCBI Life Tree : Agrobacterium tumefaciens

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MISINLYIKNIIVITTDCIALSLIILLSPPAEAASSSFNK
SRINWLPCTK PQFKFWFEGRLPPPMLECARMAAPLIYSN
RREAGSSPPRRRVSLAITRLP ATGRKQGSLVIITGGPGM
SGIIQLLDPRTDAVKRLRESYDIIRYDPRGVG QSTPKIS
CASYVSRENALVVDDAGDRAMAAYVEACIKTTGRTVLEHI
GTN EAVDDLDLLRRQLGEEFLTAIAYSYGTQVAALYAER
YPGSVRAIVLDGVV DLAEDWQTMRLNQQRGYQNTFERFV
SFCNLEKSCPFKDSVEKTTADFHRL LQAVDNRPFSTTGG
YRVTTREVLAVTTYGLLWKTHWPTLGEAFEALSNGK ADK
IKELAETILKEDEIDASVAITCADSASPTKDRQERIARAK
AVKEAAP YANYNPDVIEINVCDMWPFAGKLSARIPTLPD
NLPALLFVAQKYDPTTPH INARRMADYFRSPLVSKNADG
HTLVLTGSDKCVDQEVTSYLLKPTEPRQD KACD

References

Title : The genome of the natural genetic engineer Agrobacterium tumefaciens C58 - Wood_2001_Science_294_2317
Author(s) : Wood DW , Setubal JC , Kaul R , Monks DE , Kitajima JP , Okura VK , Zhou Y , Chen L , Wood GE , Almeida NF, Jr. , Woo L , Chen Y , Paulsen IT , Eisen JA , Karp PD , Bovee D, Sr. , Chapman P , Clendenning J , Deatherage G , Gillet W , Grant C , Kutyavin T , Levy R , Li MJ , McClelland E , Palmieri A , Raymond C , Rouse G , Saenphimmachak C , Wu Z , Romero P , Gordon D , Zhang S , Yoo H , Tao Y , Biddle P , Jung M , Krespan W , Perry M , Gordon-Kamm B , Liao L , Kim S , Hendrick C , Zhao ZY , Dolan M , Chumley F , Tingey SV , Tomb JF , Gordon MP , Olson MV , Nester EW
Ref : Science , 294 :2317 , 2001
Abstract : Wood_2001_Science_294_2317
ESTHER : Wood_2001_Science_294_2317
PubMedSearch : Wood_2001_Science_294_2317
PubMedID: 11743193
Gene_locus related to this paper: agrt5-a9cf94 , agrt5-a9cfa9 , agrt5-a9cfs8 , agrt5-a9cfu7 , agrt5-a9cie7 , agrt5-a9cj11 , agrt5-a9cjp2 , agrt5-a9cki2 , agrt5-a9ckr2 , agrt5-a9ckt2 , agrt5-a9cle4 , agrt5-a9clq8 , agrt5-a9clq9 , agrt5-q7cx24 , agrt5-q7d1j0 , agrt5-q7d1j3 , agrt5-q7d3m5 , agrt5-y5261 , agrtu-ACVB , agrtu-ATTS , agrtu-ATU0253 , agrtu-ATU0403 , agrtu-ATU0841 , agrtu-ATU1045 , agrtu-ATU1102 , agrtu-ATU1572 , agrtu-ATU1617 , agrtu-ATU1826 , agrtu-ATU1842 , agrtu-ATU2061 , agrtu-ATU2126 , agrtu-ATU2171 , agrtu-ATU2409 , agrtu-ATU2452 , agrtu-ATU2481 , agrtu-ATU2497 , agrtu-ATU2576 , agrtu-ATU3428 , agrtu-ATU3651 , agrtu-ATU3652 , agrtu-ATU4238 , agrtu-ATU5190 , agrtu-ATU5193 , agrtu-ATU5275 , agrtu-ATU5296 , agrtu-ATU5348 , agrtu-ATU5389 , agrtu-ATU5446 , agrtu-ATU5495 , agrtu-CPO , agrtu-DHAA , agrtu-DLHH , agrtu-EPHA , agrtu-GRST , agrtu-PCA , agrtu-PCAD , agrtu-PHBC , agrtu-PTRB , agrt5-a9cji8

Title : Genome sequence of the plant pathogen and biotechnology agent Agrobacterium tumefaciens C58 - Goodner_2001_Science_294_2323
Author(s) : Goodner B , Hinkle G , Gattung S , Miller N , Blanchard M , Qurollo B , Goldman BS , Cao Y , Askenazi M , Halling C , Mullin L , Houmiel K , Gordon J , Vaudin M , Iartchouk O , Epp A , Liu F , Wollam C , Allinger M , Doughty D , Scott C , Lappas C , Markelz B , Flanagan C , Crowell C , Gurson J , Lomo C , Sear C , Strub G , Cielo C , Slater S
Ref : Science , 294 :2323 , 2001
Abstract : Goodner_2001_Science_294_2323
ESTHER : Goodner_2001_Science_294_2323
PubMedSearch : Goodner_2001_Science_294_2323
PubMedID: 11743194
Gene_locus related to this paper: agrt5-a9cf94 , agrt5-a9cfa9 , agrt5-a9cfs8 , agrt5-a9cfu7 , agrt5-a9cie7 , agrt5-a9cj11 , agrt5-a9cjp2 , agrt5-a9cki2 , agrt5-a9ckr2 , agrt5-a9ckt2 , agrt5-a9cle4 , agrt5-a9clq8 , agrt5-a9clq9 , agrt5-q7cx24 , agrt5-q7d1j0 , agrt5-q7d1j3 , agrt5-q7d3m5 , agrt5-q7d3t6 , agrt5-y5261 , agrtu-ACVB , agrtu-ATTS , agrtu-ATU0253 , agrtu-ATU0403 , agrtu-ATU0841 , agrtu-ATU1045 , agrtu-ATU1102 , agrtu-ATU1572 , agrtu-ATU1617 , agrtu-ATU1826 , agrtu-ATU1842 , agrtu-ATU2061 , agrtu-ATU2126 , agrtu-ATU2171 , agrtu-ATU2409 , agrtu-ATU2452 , agrtu-ATU2481 , agrtu-ATU2497 , agrtu-ATU2576 , agrtu-ATU3428 , agrtu-ATU3651 , agrtu-ATU3652 , agrtu-ATU4238 , agrtu-ATU5190 , agrtu-ATU5193 , agrtu-ATU5275 , agrtu-ATU5296 , agrtu-ATU5348 , agrtu-ATU5389 , agrtu-ATU5446 , agrtu-ATU5495 , agrtu-CPO , agrtu-DHAA , agrtu-DLHH , agrtu-EPHA , agrtu-GRST , agrtu-PCA , agrtu-PCAD , agrtu-PHBC , agrtu-PTRB , agrt5-a9cji8