hypjq-cip2

Hypocrea jecorina (strain QM6a) (Trichoderma reesei) Cip2

Comment

"n-term Pfam A CBM_1 21 49 and low complexity -> 90 here deleted" || "Other strains: Trichoderma Hypocrea jecorina (strain ATCC 56765 \/ BCRC 32924 \/ NRRL 11460 \/ Rut C-30)"

Relationship

Family : Glucuronoyl_esterase

Block : X

Position in NCBI Life Tree : Hypocrea jecorina

Molecular evidence

No mutation

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

ATCSALPGSITLRSNAKLNDLFTMFNGDKVTTKDKFSCRQ
AEMSELIQRY ELGTLPGRPSTLTASFSGNTLTINCGEAG
KSISFTVTITYPSSGTAPYPA IIGYGGGSLPAPAGVAMI
NFNNDNIAAQVNTGSRGQGKFYDLYGSSHSAG AMTAWAW
GVSRVIDALELVPGARIDTTKIGVTGCSRNGKGAMVAGAF
EKR IVLTLPQESGAGGSACWRISDYLKSQGANIQTASEI
IGEDPWFSTTFNSY VNQVPVLPFDHHSLAALIAPRGLFV
IDNNIDWLGPQSCFGCMTAAHMAWQ ALGVSDHMGYSQIG
AHAHCAFPSNQQSQLTAFVQKFLLGQSTNTAIFQSD FSA
NQSQWIDWTTPTLS

References

Title : Functional Cloning and Expression of the Schizophyllum commune Glucuronoyl Esterase Gene and Characterization of the Recombinant Enzyme - Wong_2012_Biotechnol.Res.Int_2012_951267
Author(s) : Wong DW , Chan VJ , McCormack AA , Hirsch J , Biely P
Ref : Biotechnol Res Int , 2012 :951267 , 2012
Abstract : Wong_2012_Biotechnol.Res.Int_2012_951267
ESTHER : Wong_2012_Biotechnol.Res.Int_2012_951267
PubMedSearch : Wong_2012_Biotechnol.Res.Int_2012_951267
PubMedID: 22844600
Gene_locus related to this paper: hypjq-cip2

Title : Structure of the catalytic domain of glucuronoyl esterase Cip2 from Hypocrea jecorina - Pokkuluri_2011_Proteins_79_2588
Author(s) : Pokkuluri PR , Duke NE , Wood SJ , Cotta MA , Li XL , Biely P , Schiffer M
Ref : Proteins , 79 :2588 , 2011
Abstract : Pokkuluri_2011_Proteins_79_2588
ESTHER : Pokkuluri_2011_Proteins_79_2588
PubMedSearch : Pokkuluri_2011_Proteins_79_2588
PubMedID: 21661060
Gene_locus related to this paper: hypjq-cip2

Title : Identification of genes encoding microbial glucuronoyl esterases - Li_2007_FEBS.Lett_581_4029
Author(s) : Li XL , Spanikova S , de Vries RP , Biely P
Ref : FEBS Letters , 581 :4029 , 2007
Abstract : Li_2007_FEBS.Lett_581_4029
ESTHER : Li_2007_FEBS.Lett_581_4029
PubMedSearch : Li_2007_FEBS.Lett_581_4029
PubMedID: 17678650
Gene_locus related to this paper: hypjq-cip2

Title : Transcriptional regulation of biomass-degrading enzymes in the filamentous fungus Trichoderma reesei - Foreman_2003_J.Biol.Chem_278_31988
Author(s) : Foreman PK , Brown D , Dankmeyer L , Dean R , Diener S , Dunn-Coleman NS , Goedegebuur F , Houfek TD , England GJ , Kelley AS , Meerman HJ , Mitchell T , Mitchinson C , Olivares HA , Teunissen PJ , Yao J , Ward M
Ref : Journal of Biological Chemistry , 278 :31988 , 2003
Abstract : Foreman_2003_J.Biol.Chem_278_31988
ESTHER : Foreman_2003_J.Biol.Chem_278_31988
PubMedSearch : Foreman_2003_J.Biol.Chem_278_31988
PubMedID: 12788920
Gene_locus related to this paper: hypjq-cip2 , hypje-q7z9m3