9acto-f7ix06

 
Thermobifida alba Esterase TaEst119

Relationship
Block L
Thermobifida alba position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptosporangiales: N E > Nocardiopsaceae: N E > Thermobifida: N E > Thermobifida alba: N E

Molecular evidence
Database
No mutation
3 structures: 6AID, 3WYN, 3VIS
No kinetic

Substrate: Polylactic-acid , HEMT , Polyethylene-terephthalate , PBAT , Ethyl-lactate , Paranitrophenylbutyrate ,
Inhibitor: Lactic-acid ,
2 Genbank : BAK48590, AB445476
1 UniProt : F7IX06
3 Structure : 6AID, 3WYN, 3VIS
1 UniProtTrembl : F7IX06
1 Interpro : F7IX06
1 Prodom : F7IX06
1 Pfam : F7IX06
1 PIRSF : F7IX06
1 SUPERFAM : F7IX06
1 QuickSwissBlast : F7IX06
 
Sequence
Graphical view for this peptide sequence: 9acto-f7ix06
Colored MSA for Polyesterase-lipase-cutinase (raw)
MSVTTPRRETSLLSRALRATAAAATAVVATVALAAPAQAANPYERGPNPT
ESMLEARSGPFSVSEERASRFGADGFGGGTIYYPRENNTYGAIAISPGYT
GTQSSIAWLGERIASHGFVVIAIDTNTTLDQPDSRARQLNAALDYMLTDA
SSAVRNRIDASRLAVMGHSMGGGGTLRLASQRPDLKAAIPLTPWHLNKSW
RDITVPTLIIGAEYDTIASVTLHSKPFYNSIPSPTDKAYLELDGASHFAP
NITNKTIGMYSVAWLKRFVDEDTRYTQFLCPGPRTGLLSDVEEYRSTCPF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSVTTPRRETSLLSRALRATAAAATAVVATVALAAPAQAANPYERGPNPT
ESMLEARSGPFSVSEERASRFGADGFGGGTIYYPRENNTYGAIAISPGYT
GTQSSIAWLGERIASHGFVVIAIDTNTTLDQPDSRARQLNAALDYMLTDA
SSAVRNRIDASRLAVMGHSMGGGGTLRLASQRPDLKAAIPLTPWHLNKSW
RDITVPTLIIGAEYDTIASVTLHSKPFYNSIPSPTDKAYLELDGASHFAP
NITNKTIGMYSVAWLKRFVDEDTRYTQFLCPGPRTGLLSDVEEYRSTCPF

no DNA




References
4 more
    Title: The Current State of Research on PET Hydrolyzing Enzymes Available for Biorecycling
    Kawai F
    Ref: Catalysts, 11:206, 2021 : PubMed

            

    Title: Structural insights into the unique polylactate-degrading mechanism of Thermobifida alba cutinase
    Kitadokoro K, Kakara M, Matsui S, Osokoshi R, Thumarat U, Kawai F, Kamitani S
    Ref: Febs J, 286:2087, 2019 : PubMed

            

    Title: Diversity of polyester-degrading bacteria in compost and molecular analysis of a thermoactive esterase from Thermobifida alba AHK119
    Hu X, Thumarat U, Zhang X, Tang M, Kawai F
    Ref: Applied Microbiology & Biotechnology, 87:771, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer