9psed-peh

 
Pseudomonas aestusnigri alpha/beta hydrolase Polyester hydrolase PE-H PaPETase

Comment
Pseudomonas aestusnigri VGXO14T, CE16 in Bollinger et al. 2020


Relationship
Block L
Pseudomonas aestusnigri position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas pertucinogena group: N E > Pseudomonas aestusnigri: N E

Molecular evidence
Database
No mutation
2 structures: 6SBN, 6SCD
No kinetic



2 Genbank : WP_088276085, OWL88088
1 UniProt : A0A1H6AD45
2 Structure : 6SBN, 6SCD
1 UniProtTrembl : A0A1H6AD45
1 Interpro : A0A1H6AD45
1 Prodom : A0A1H6AD45
1 Pfam : A0A1H6AD45
1 PIRSF : A0A1H6AD45
1 SUPERFAM : A0A1H6AD45
1 QuickSwissBlast : A0A1H6AD45
 
Sequence
Graphical view for this peptide sequence: 9psed-peh
Colored MSA for Polyesterase-lipase-cutinase (raw)
MPFNKKSVLALCGAGALLFSMSALANNPAPTDPGDSGGGSAYQRGPDPSV
SFLEADRGQYSVRSSRVSSLVSGFGGGTIYYPTGTTGTMGAVVVIPGFVS
AESSIDWWGPKLASYGFVVMTIDTNTGFDQPPSRARQINNALDYLVSQNS
RSSSPVRGMIDTNRLGVIGWSMGGGGTLRVASEGRIKAAIPLAPWDTTSY
YASRSQAPTLIFACESDVIAPVLQHASPFYNSLPSSIDKAFVEINGGSHY
CGNGGSIYNDVLSRFGVSWMKLHLDEDSRYKQFLCGPNHTSDSQISDYRG
NCPY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPFNKKSVLALCGAGALLFSMSALANNPAPTDPGDSGGGSAYQRGPDPSV
SFLEADRGQYSVRSSRVSSLVSGFGGGTIYYPTGTTGTMGAVVVIPGFVS
AESSIDWWGPKLASYGFVVMTIDTNTGFDQPPSRARQINNALDYLVSQNS
RSSSPVRGMIDTNRLGVIGWSMGGGGTLRVASEGRIKAAIPLAPWDTTSY
YASRSQAPTLIFACESDVIAPVLQHASPFYNSLPSSIDKAFVEINGGSHY
CGNGGSIYNDVLSRFGVSWMKLHLDEDSRYKQFLCGPNHTSDSQISDYRG
NCPY

no DNA




References
    Title: Perspectives on the Role of Enzymatic Biocatalysis for the Degradation of Plastic PET
    Magalhaes RP, Cunha JM, Sousa SF
    Ref: Int J Mol Sci, 22:11257, 2021 : PubMed

            

    Title: A Novel Polyester Hydrolase From the Marine Bacterium Pseudomonas aestusnigri - Structural and Functional Insights
    Bollinger A, Thies S, Knieps-Grunhagen E, Gertzen C, Kobus S, Hoppner A, Ferrer M, Gohlke H, Smits SHJ, Jaeger KE
    Ref: Front Microbiol, 11:114, 2020 : PubMed

            

    Title: Organic-Solvent-Tolerant Carboxylic Ester Hydrolases for Organic Synthesis
    Bollinger A, Molitor R, Thies S, Koch R, Coscolin C, Ferrer M, Jaeger KE
    Ref: Applied Environmental Microbiology, 86:e00106, 2020 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer