Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: anoga-Q7PVF9

Anopheles gambiae (African malaria mosquito); A. stephensi (Indo-Pakistan malaria mosquito); A. christyi; A. quadriannulatus; A. epiroticus; A. funestus (African malaria mosquito); A. arabiensis; A. coluzzii; A farauti; A sinensis; A darlingi AGAP009289-PA ABHD11

Comment
Other strains: Anopheles gambiae (African malaria mosquito); Anopheles stephensi (Indo-Pakistan malaria mosquito); Anopheles christyi; Anopheles quadriannulatus; Anopheles epiroticus; Anopheles funestus (African malaria mosquito); Anopheles arabiensis (Mosquito); Anopheles coluzzii; Anopheles farauti; Anopheles sinensis; Anopheles darlingi


Relationship
Family|ABHD11-Acetyl_transferase
Block| X
Position in NCBI Life Tree|Anopheles gambiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Nematocera: N E > Culicomorpha: N E > Culicoidea: N E > Culicidae: N E > Anophelinae: N E > Anopheles [genus]: N E > Cellia: N E > Pyretophorus: N E > gambiae species complex: N E > Anopheles gambiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: anoga-Q7PVF9
Colored MSA for ABHD11-Acetyl_transferase (raw)
PAPVALSFTRYENNASDSNAPPVMVLHGLFGSKSNWNSLGKAFHKNTKPV
RKIYAIDARNHGDSPHTDEHSYDHMVEDLVQLYKTLSIDKASIIGHSMGG
RAMMLLALKYPELVEKAIIVDISPSTGLGTSNTNIPLFLQSMKMIQISPT
ATIHQARKLADEQLARIIAEKSLRDFLITNLVKAEKEGGHFRWRINLEAL
ERNFNTGVAQFPQLTGRKFEGPTLFIAGGRSDYVKSEDVPLIKTLFPNSE
ITYVKDAGHWVHSEKSTEFSKLVLNFLNE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

PAPVALSFTRYENNASDSNAPPVMVLHGLFGSKSNWNSLGKAFHKNTKPV
RKIYAIDARNHGDSPHTDEHSYDHMVEDLVQLYKTLSIDKASIIGHSMGG
RAMMLLALKYPELVEKAIIVDISPSTGLGTSNTNIPLFLQSMKMIQISPT
ATIHQARKLADEQLARIIAEKSLRDFLITNLVKAEKEGGHFRWRINLEAL
ERNFNTGVAQFPQLTGRKFEGPTLFIAGGRSDYVKSEDVPLIKTLFPNSE
ITYVKDAGHWVHSEKSTEFSKLVLNFLNE


References
2 more
    Title: Genome analysis of a major urban malaria vector mosquito, Anopheles stephensi
    Jiang X, Peery A, Hall AB, Sharma A, Chen XG, Waterhouse RM, Komissarov A, Riehle MM, Shouche Y and Tu Z <25 more author(s)>
    Ref: Genome Biol, 15:459, 2014 : PubMed

            

    Title: Genome sequence of Anopheles sinensis provides insight into genetics basis of mosquito competence for malaria parasites
    Zhou D, Zhang D, Ding G, Shi L, Hou Q, Ye Y, Xu Y, Zhou H, Xiong C and Zhu C <12 more author(s)>
    Ref: BMC Genomics, 15:42, 2014 : PubMed

            

    Title: Widespread divergence between incipient Anopheles gambiae species revealed by whole genome sequences
    Lawniczak MK, Emrich SJ, Holloway AK, Regier AP, Olson M, White B, Redmond S, Fulton L, Appelbaum E and Besansky NJ <20 more author(s)>
    Ref: Science, 330:512, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer