Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-a0a1p8bcz0

Arabidopsis thaliana (Mouse-ear cress). Alpha/beta-Hydrolases superfamily protein

Relationship
Family|Triacylglycerol-lipase-OBL1-like
Block| L
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CP002688, NP_001331139
1 UniProt : A0A1P8BCZ0
1 UniProt : A0A1P8BCZ0
1 Interpro : A0A1P8BCZ0
1 Prodom : A0A1P8BCZ0
1 Pfam : A0A1P8BCZ0
1 PIRSF : A0A1P8BCZ0
1 SUPERFAM : A0A1P8BCZ0
Sequence
Graphical view for this peptide sequence: arath-a0a1p8bcz0
Colored MSA for Triacylglycerol-lipase-OBL1-like (raw)
MSRTKNYFVLDPREATVSDLIHLLFSSDLGDRKFIHSSEERIEDDLSRFR
RRWIIFVSIVIQKLIILFKKPLYFVGFSLACWLNLLSSNGGFLMILPNLF
KGNIIWPEKASATFASLNGNLDRRVELNPKVERGSKRYKAMLSIMASKLS
YENINFVSSVLHNHWKMDLLGFYSCWNGYQKQRSTEVIVIKDTSTDPNLI
IVSFRGTDPFDADDWCTDLDLSWYEVKNVGKIHGGFMKALGLQKEGWPKE
VNLDETQNATTLYAYYTVRRHLKEILDQNPTSKFILTGHSLGGALAILFT
AVLVMHDEEQMLERLEGVYTFGQPRVGDEEFGNFMKDSLKKFDVKYERYV
YCNDMVPRLPFDDKTLMFKHFGACLYYDSFYKGKVGCIYMTILFLCFNHS
SV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSRTKNYFVLDPREATVSDLIHLLFSSDLGDRKFIHSSEERIEDDLSRFR
RRWIIFVSIVIQKLIILFKKPLYFVGFSLACWLNLLSSNGGFLMILPNLF
KGNIIWPEKASATFASLNGNLDRRVELNPKVERGSKRYKAMLSIMASKLS
YENINFVSSVLHNHWKMDLLGFYSCWNGYQKQRSTEVIVIKDTSTDPNLI
IVSFRGTDPFDADDWCTDLDLSWYEVKNVGKIHGGFMKALGLQKEGWPKE
VNLDETQNATTLYAYYTVRRHLKEILDQNPTSKFILTGHSLGGALAILFT
AVLVMHDEEQMLERLEGVYTFGQPRVGDEEFGNFMKDSLKKFDVKYERYV
YCNDMVPRLPFDDKTLMFKHFGACLYYDSFYKGKVGCIYMTILFLCFNHS
SV


References
    Title: Araport11: a complete reannotation of the Arabidopsis thaliana reference genome
    Cheng CY, Krishnakumar V, Chan AP, Thibaud-Nissen F, Schobel S, Town CD
    Ref: Plant J, 89:789, 2017 : PubMed

            

    Title: Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana
    Tabata S, Kaneko T, Nakamura Y, Kotani H, Kato T, Asamizu E, Miyajima N, Sasamoto S, Kimura T and Fransz P <119 more author(s)>
    Ref: Nature, 408:823, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer