Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacah-a0rer5

Bacillus thuringiensis, Bacillus cereus, Bacillus anthracis, Hydrolase, alpha/beta fold family

Comment
Other strains: Bacillus thuringiensis (strain Al Hakam; serovars pondicheriensis BGSC 4BA1; monterrey BGSC 4AJ1; andalousiensis BGSC 4AW1; pulsiensis BGSC 4CC1) Bacillus cereus (strains 95/8201; AH820; 03BB102; 03BB108; BGSC 6E1; NVH0597-99; H3081.97; Q1; AH187; BDRD-ST26) Bacillus anthracis (strains CDC 684 / NRRL 3495; A0174; A0442; A0465; A0389; A0488; A0248; A0193; Tsiankovskii-I)


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Bacillus thuringiensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus thuringiensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: bacah-a0rer5
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MKISDRRFDMWTTNIIKTPRGKFEYFLKGEGPPLCVTHLYSEYNDNGNTF
ANPFTDHYSVYLVNLKGCGNSDSAKNDSEYSMTETIKDLEAIREALYINK
WGFAGHSTGGMLALVYATEAQESLTKIIVGGAAASKEYASHKDSIYCSEN
KNFNKILLIMNALNDDSTLQEERKALSREWALMSFYSEEKLEEALKLPNS
GKTVGNRLNYFRQVEYKDYDVRQKLKFVKIPSFIYCGKHDAQCPYIFSRE
IANLIPNATLTKFEESNHNPFVEEIDKFNQFVNDTL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKISDRRFDMWTTNIIKTPRGKFEYFLKGEGPPLCVTHLYSEYNDNGNTF
ANPFTDHYSVYLVNLKGCGNSDSAKNDSEYSMTETIKDLEAIREALYINK
WGFAGHSTGGMLALVYATEAQESLTKIIVGGAAASKEYASHKDSIYCSEN
KNFNKILLIMNALNDDSTLQEERKALSREWALMSFYSEEKLEEALKLPNS
GKTVGNRLNYFRQVEYKDYDVRQKLKFVKIPSFIYCGKHDAQCPYIFSRE
IANLIPNATLTKFEESNHNPFVEEIDKFNQFVNDTL


References
    Title: Complete genome sequence of the extremophilic Bacillus cereus strain Q1 with industrial applications
    Xiong Z, Jiang Y, Qi D, Lu H, Yang F, Yang J, Chen L, Sun L, Xu X and Jin Q <2 more author(s)>
    Ref: Journal of Bacteriology, 191:1120, 2009 : PubMed

            

    Title: The complete genome sequence of Bacillus thuringiensis Al Hakam
    Challacombe JF, Altherr MR, Xie G, Bhotika SS, Brown N, Bruce D, Campbell CS, Campbell ML, Chen J and Brettin TS <38 more author(s)>
    Ref: Journal of Bacteriology, 189:3680, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer