Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacan-BA2694

Bacillus anthracis (strain Ames)Bacillus thuringiensis serovar kurstaki str. T03a001 Bacillus cereus ATCC 10876 esterase, putative

Relationship
Family|A85-IroE-IroD-Fes-Yiel
Block| X
Position in NCBI Life Tree|Bacillus anthracis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus anthracis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AE017225, AE017032, ACND01000076
1 UniProt : Q81PV0
1 Interpro : Q81PV0
1 Pfam : Q81PV0
1 PIRSF : Q81PV0
1 SUPERFAM : Q81PV0
Sequence
Graphical view for this peptide sequence: bacan-BA2694
Colored MSA for A85-IroE-IroD-Fes-Yiel (raw)
MRKLHIEYYKGGREVTTIISPKLEKLKNHLKNGNEKALYTFLHEIKSNHT
PLVEQCPIDNQYKLITYIWLGDQNTENVYVVGSFPGWDLSVNQLQRLLQT
NIWYVTFRTNKRFISTYYFTVNDFFKNDWIKRSEQYRLDPFNENVFGEGA
NKASVLKIDMDVQYSSRFPSNHYPSGKIETYSFYSSILNNTRKLHIYTPH
DYSHTSHLQELLIVFDGNSFINDLSITKTLNYLIYEKEIPSCIAVAIDPV
DRLEELTYNDKMNTFLMKELLPWIQTKYHVYQKAKHTTIAGFSLGGLAAF
YVALQNPHIFGNVLSMSGSVHWKKDDYENTIPWIENQISSIDSNATHLNS
YIAVGELENESLLKANRRLHKALEEKKYPNHL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRKLHIEYYKGGREVTTIISPKLEKLKNHLKNGNEKALYTFLHEIKSNHT
PLVEQCPIDNQYKLITYIWLGDQNTENVYVVGSFPGWDLSVNQLQRLLQT
NIWYVTFRTNKRFISTYYFTVNDFFKNDWIKRSEQYRLDPFNENVFGEGA
NKASVLKIDMDVQYSSRFPSNHYPSGKIETYSFYSSILNNTRKLHIYTPH
DYSHTSHLQELLIVFDGNSFINDLSITKTLNYLIYEKEIPSCIAVAIDPV
DRLEELTYNDKMNTFLMKELLPWIQTKYHVYQKAKHTTIAGFSLGGLAAF
YVALQNPHIFGNVLSMSGSVHWKKDDYENTIPWIENQISSIDSNATHLNS
YIAVGELENESLLKANRRLHKALEEKKYPNHL


Reference
    Title: The genome sequence of Bacillus anthracis Ames and comparison to closely related bacteria
    Read TD, Peterson SN, Tourasse N, Baillie LW, Paulsen IT, Nelson KE, Tettelin H, Fouts DE, Eisen JA and Fraser CM <42 more author(s)>
    Ref: Nature, 423:81, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer