Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacce-c2mr40

Bacillus cereus (strains m1293; Q1; H3081.97; AH187; BDRD-ST26; ZK/E33L) Putative uncharacterized protein

Relationship
Family|HNLyase_Bact
Block| X
Position in NCBI Life Tree|Bacillus cereus m1293
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus cereus: N E > Bacillus cereus m1293: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: ACLS01000102, CP000227, ABDL02000009
>3 UniProt links 2 more: C2MR40, B9IYX9, B7HQG4
>3 UniProt links 2 more: C2MR40, B9IYX9, B7HQG4
>3 Interpro links 2 more: C2MR40, B9IYX9, B7HQG4
>3 Prodom links 2 more: C2MR40, B9IYX9, B7HQG4
>3 Pfam links 2 more: C2MR40, B9IYX9, B7HQG4
>3 PIRSF links 2 more: C2MR40, B9IYX9, B7HQG4
>3 SUPERFAM links 2 more: C2MR40, B9IYX9, B7HQG4
Sequence
Graphical view for this peptide sequence: bacce-c2mr40
Colored MSA for HNLyase_Bact (raw)
MIVKKINDIIGGLWEVKLMETFVLVHGAWDGGYVWKKLAELLREEGHSVY
TPTLTGLGERTHLMQPNIGLKTFIQDIVNTIKYQGLKDVILVGHSYSGMV
ITGVAEVIPEFIKELVYVDAMLPEDGDSVMDISGPEMAAHFIEEVKVYGE
GWRVLPRNTIDERKSAMPLLAFTQSVEIKNFKAQCIPHIYVEVKDNPEHW
PMTSIFLESAKKARDRKWEVFSIEVGGHWVMETNPEALVRILNQSVEVI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIVKKINDIIGGLWEVKLMETFVLVHGAWDGGYVWKKLAELLREEGHSVY
TPTLTGLGERTHLMQPNIGLKTFIQDIVNTIKYQGLKDVILVGHSYSGMV
ITGVAEVIPEFIKELVYVDAMLPEDGDSVMDISGPEMAAHFIEEVKVYGE
GWRVLPRNTIDERKSAMPLLAFTQSVEIKNFKAQCIPHIYVEVKDNPEHW
PMTSIFLESAKKARDRKWEVFSIEVGGHWVMETNPEALVRILNQSVEVI


References
    Title: Complete genome sequence of the extremophilic Bacillus cereus strain Q1 with industrial applications
    Xiong Z, Jiang Y, Qi D, Lu H, Yang F, Yang J, Chen L, Sun L, Xu X and Jin Q <2 more author(s)>
    Ref: Journal of Bacteriology, 191:1120, 2009 : PubMed

            

    Title: Pathogenomic sequence analysis of Bacillus cereus and Bacillus thuringiensis isolates closely related to Bacillus anthracis
    Han CS, Xie G, Challacombe JF, Altherr MR, Bhotika SS, Brown N, Bruce D, Campbell CS, Campbell ML and Gilna P <38 more author(s)>
    Ref: Journal of Bacteriology, 188:3382, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer