Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacce-lipP

Bacillus cereus lipW lipP lipase

Comment
Other strains: Bacillus cereus (ZK; ATCC 10987; Rock3-42; ATCC 10987; subsp. cytotoxis NVH 391-98; 03BB102; NVH0597-99; R309803; H3081.97; BDRD-ST26; AH187; var. anthracis CI), Bacillus thuringiensis serovar huazhongensis BGSC 4BD1)


Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Bacillus cereus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus cereus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CP000001, AE017274
>3 UniProt links 5 more: Q734Z8, Q63FH3, C2VPI6
>3 UniProt links 5 more: Q734Z8, Q63FH3, C2VPI6
>3 Interpro links 5 more: Q734Z8, Q63FH3, C2VPI6
>3 Pfam links 5 more: Q734Z8, Q63FH3, C2VPI6
>3 PIRSF links 5 more: Q734Z8, Q63FH3, C2VPI6
>3 SUPERFAM links 5 more: Q734Z8, Q63FH3, C2VPI6
Sequence
Graphical view for this peptide sequence: bacce-lipP
Colored MSA for Hormone-sensitive_lipase_like (raw)
MKNRVNPVLLPGLEMYPDQDLRPECLPTMREEASKVFPPTIIDETLSVTN
EVIEGPDANPLRLKIYRPKSNNESLPALLWIHGGGYILGSINDNDDLAVK
IAKEANCMVVSVDYRLAPEHPYPAPIEDCYAALKWIADNAETLNIDSNRI
GVAGVSAGGGLTAALTLLARDRQYPSICFQMPLYPMIDDRNNTPSANEIK
KGFVWNQKSNEAGWKMYLGKLHGTDHIPAYAAAARAEDYRNLPRTYTCVG
QLDPFRSETLTYVTKLAEAGVDVEFHLYPGAYHGFEMMHPDADISVHAWN
DYVRAVKTGFAKKELR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKNRVNPVLLPGLEMYPDQDLRPECLPTMREEASKVFPPTIIDETLSVTN
EVIEGPDANPLRLKIYRPKSNNESLPALLWIHGGGYILGSINDNDDLAVK
IAKEANCMVVSVDYRLAPEHPYPAPIEDCYAALKWIADNAETLNIDSNRI
GVAGVSAGGGLTAALTLLARDRQYPSICFQMPLYPMIDDRNNTPSANEIK
KGFVWNQKSNEAGWKMYLGKLHGTDHIPAYAAAARAEDYRNLPRTYTCVG
QLDPFRSETLTYVTKLAEAGVDVEFHLYPGAYHGFEMMHPDADISVHAWN
DYVRAVKTGFAKKELR


References
    Title: Genomic characterization of the Bacillus cereus sensu lato species: backdrop to the evolution of Bacillus anthracis
    Zwick ME, Joseph SJ, Didelot X, Chen PE, Bishop-Lilly KA, Stewart AC, Willner K, Nolan N, Lentz S and Read TD <4 more author(s)>
    Ref: Genome Res, 22:1512, 2012 : PubMed

            

    Title: Extending the Bacillus cereus group genomics to putative food-borne pathogens of different toxicity
    Lapidus A, Goltsman E, Auger S, Galleron N, Segurens B, Dossat C, Land ML, Broussolle V, Brillard J and Sorokin A <8 more author(s)>
    Ref: Chemico-Biological Interactions, 171:236, 2008 : PubMed

            

    Title: The genome sequence of Bacillus cereus ATCC 10987 reveals metabolic adaptations and a large plasmid related to Bacillus anthracis pXO1
    Rasko DA, Ravel J, Okstad OA, Helgason E, Cer RZ, Jiang L, Shores KA, Fouts DE, Tourasse NJ and Read TD <5 more author(s)>
    Ref: Nucleic Acids Research, 32:977, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer