Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: biooc-ZHD101

Bionectria ochroleuca (Gliocladium roseum), Clonostachys rosea f. rosea, zearalenone hydrolase ZHD101 ZEN-JJM

Relationship
Family|Zearalenone-hydrolase
Block| X
Position in NCBI Life Tree|Bionectria ochroleuca
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Bionectriaceae: N E > Clonostachys: N E > Clonostachys rosea: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
19 structures (e.g. : 3WZL, 3WZM, 5C7Y... more)
No kinetic





3 substrates: Alpha-zearalenol, Beta-zearalenol, Zearalenone
2 inhibitors: ZFR, ZGR
>3 Genbank links 14 more: AB076037, JN210552, GQ849012
>3 UniProt links 6 more: G9FTK5, C9EIK3, A0A023IYH9
>3 Structure links 16 more: 5C7Y, 5C81, 5C8Z
>3 UniProt links 7 more: Q8NKB0, G9FTK5, C9EIK3
>3 Interpro links 7 more: Q8NKB0, G9FTK5, C9EIK3
>3 Prodom links 7 more: Q8NKB0, G9FTK5, C9EIK3
>3 Pfam links 7 more: Q8NKB0, G9FTK5, C9EIK3
>3 PIRSF links 7 more: Q8NKB0, G9FTK5, C9EIK3
>3 SUPERFAM links 7 more: Q8NKB0, G9FTK5, C9EIK3
Sequence
Graphical view for this peptide sequence: biooc-ZHD101
Colored MSA for Zearalenone-hydrolase (raw)
MRTRSTISTPNGITWYYEQEGTGPDIVLVPDGLGECQMFDSSVSQIAAQG
FRVTTFDMPGMSRSAKAPAETYTEVTAQKLASYVISILDALDIKHATVWG
CSSGASTVVALLLGYPDRIRNAMCHELPTKLLDHLSNTAVLEDEEISNIL
ANVMLNDVSGGSEAWQALGVEVHARLHKNYPVWARGYPRTIPPSAPVQDV
EALRGKPLDWTVGAATPTESFFDNIVTATKAGVNIGLLPGMHFPYVSHPD
VFAKYVVETTQKHL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRTRSTISTPNGITWYYEQEGTGPDIVLVPDGLGECQMFDSSVSQIAAQG
FRVTTFDMPGMSRSAKAPAETYTEVTAQKLASYVISILDALDIKHATVWG
CSSGASTVVALLLGYPDRIRNAMCHELPTKLLDHLSNTAVLEDEEISNIL
ANVMLNDVSGGSEAWQALGVEVHARLHKNYPVWARGYPRTIPPSAPVQDV
EALRGKPLDWTVGAATPTESFFDNIVTATKAGVNIGLLPGMHFPYVSHPD
VFAKYVVETTQKHL


References
15 more
    Title: The Trp183 is essential in lactonohydrolase ZHD detoxifying zearalenone and zearalenols
    Zhou H, Li L, Zhan B, Wang S, Li J, Hu XJ
    Ref: Biochemical & Biophysical Research Communications, 522:986, 2020 : PubMed

            

    Title: Isolation and characterisation of enzymatic zearalenone hydrolysis reaction products
    Vekiru E, Fruhauf S, Hametner C, Schatzmayr G, Krska R, Moll WD, Schuhmacher R
    Ref: World Mycotoxin Journal, 9:353, 2016 : PubMed

            

    Title: Enhanced alpha-Zearalenol Hydrolyzing Activity of a Mycoestrogen-Detoxifying Lactonase by Structure-Based Engineering
    Xu Z, Liu W, Chen CC, Li Q, Huang JW, Ko TP, Liu G, Peng W, Cheng YS and Guo RT <4 more author(s)>
    Ref: ACS Catal, 6:7657, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer