Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bommo-ACHE1

Bombyx mori (Silk moth) Bombyx mandarina (Wild silk moth) (Wild silkworm) acetylcholinesterase type 1 (ace1)

Comment
Some differences between the japanese (Q08LY8 called Acetylcholinesterse type II ace2 Kazuma T., Shiotsuki T., Seino A., Tan A., Kono Y.) and chinese (Q2Q5Z2 called ace1 Shang J.-Y., Zhang C.-X., Tang Z.-H.) and wild type Bombyx mandarina (A2IBS5 Li B., Wang D., Chen Y.H., Wei Z.G., Zhao H.Q., Xu Y.X., Wang W.B., Shen W.D.) strains


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Bombyx mori
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Amphiesmenoptera: N E > Lepidoptera: N E > Glossata: N E > Neolepidoptera: N E > Heteroneura: N E > Ditrysia: N E > Obtectomera: N E > Bombycoidea: N E > Bombycidae: N E > Bombycinae: N E > Bombyx: N E > Bombyx mori: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
1 mutation: bommo-ACHE1
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 4 more: DQ186605, DQ186606, AB189740
>3 UniProt links 2 more: Q2Q5Z2, Q08LY8, A2IBS5
2 Ncbi-nid : 77921150, 77921152
2 Ncbi-pid : 77921151, 77921153
>3 UniProt links 2 more: Q2Q5Z2, Q08LY8, A2IBS5
>3 Interpro links 2 more: Q2Q5Z2, Q08LY8, A2IBS5
>3 Prodom links 2 more: Q2Q5Z2, Q08LY8, A2IBS5
>3 Pfam links 2 more: Q2Q5Z2, Q08LY8, A2IBS5
>3 PIRSF links 2 more: Q2Q5Z2, Q08LY8, A2IBS5
>3 SUPERFAM links 2 more: Q2Q5Z2, Q08LY8, A2IBS5
Sequence
Graphical view for this peptide sequence: bommo-ACHE1
Colored MSA for ACHE (raw)
MRVVLAALTALAARTLAGPHEHRARHHAPAPPQPYHGHGEAVRYNPELDT
ILPRLEDHETSSKRASDAETSSKRTKYEERFYSNHERAAELMADEPVSEK
GDEEDPLVIRTRKGKVRGITLTSATGKKVDAWFGIPYAQKPMGDLRFRHP
RPVEDWGDEILNTTTLPHSCVQIVDTVFGDFPGAMMWNPNTDMQEDCLYI
NIVTPRPRPKNAAVMLWVFGGGFYSGTATLDVYDPKILVSEEKVVYVSMQ
YRVASLGFLFFDTADVPGNAGLFDQLMALQWVKDNIGYFGGNPHNITLFG
ESAGAVSVSLHLLSPLSRNLFSQAIMQSGAATAPWAIISREESILRGIRL
AEAVHCPHSRSDLAPMIECLRKKNADELVNNEWGTLGICEFPFVPIIDGS
FLDEMPVRSLAHQNFKKTNILMGSNTEEGYYFILYYLTELFPKEENVGIS
REQFLQAVRELNPYVNDVARQAIIYEYTDWLNPEDPVKNRNALDKMVGDY
HFTCGVNEFAHRYAETGNNVYTYYYKHRSKNNPWPSWTGVMHADEINYVF
GEPLNPGKNYSPEEVEFSKRLMRYWANFARSGNPSLNPNGEMTKIHWPVH
TAFGREYLSLAVNSSSVGRGLRVKQCAFWQKHLPQLMAATNKPEPPKNCT
NSVPSLWPSRNTLGFNVIATAALTGTALFKYTI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRVVLAALTALAARTLAGPHEHRARHHAPAPPQPYHGHGEAVRYNPELDT
ILPRLEDHETSSKRASDAETSSKRTKYEERFYSNHERAAELMADEPVSEK
GDEEDPLVIRTRKGKVRGITLTSATGKKVDAWFGIPYAQKPMGDLRFRHP
RPVEDWGDEILNTTTLPHSCVQIVDTVFGDFPGAMMWNPNTDMQEDCLYI
NIVTPRPRPKNAAVMLWVFGGGFYSGTATLDVYDPKILVSEEKVVYVSMQ
YRVASLGFLFFDTADVPGNAGLFDQLMALQWVKDNIGYFGGNPHNITLFG
ESAGAVSVSLHLLSPLSRNLFSQAIMQSGAATAPWAIISREESILRGIRL
AEAVHCPHSRSDLAPMIECLRKKNADELVNNEWGTLGICEFPFVPIIDGS
FLDEMPVRSLAHQNFKKTNILMGSNTEEGYYFILYYLTELFPKEENVGIS
REQFLQAVRELNPYVNDVARQAIIYEYTDWLNPEDPVKNRNALDKMVGDY
HFTCGVNEFAHRYAETGNNVYTYYYKHRSKNNPWPSWTGVMHADEINYVF
GEPLNPGKNYSPEEVEFSKRLMRYWANFARSGNPSLNPNGEMTKIHWPVH
TAFGREYLSLAVNSSSVGRGLRVKQCAFWQKHLPQLMAATNKPEPPKNCT
NSVPSLWPSRNTLGFNVIATAALTGTALFKYTI


References
3 more
    Title: Two Bombyx mori acetylcholinesterase genes influence motor control and development in different ways
    Ye X, Yang L, Stanley D, Li F, Fang Q
    Ref: Sci Rep, 7:4985, 2017 : PubMed

            

    Title: Expression and effects of mutant Bombyx mori acetylcholinesterase 1 in BmN Cells
    Wang BB, Xie Y, Li FC, Ni M, Xu KZ, Tian JH, Hu JS, Xue B, Shen WD, Li B
    Ref: Archives of Insect Biochemistry & Physiology, 93:110, 2016 : PubMed

            

    Title: Analysis of two acetylcholinesterase genes in Bombyx mori
    Seino A, Kazuma T, Tan AJ, Tanaka H, Kono Y, Mita K, Shiotsuki T
    Ref: Pesticide Biochemistry and Physiology, 88:92, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer