Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: canpc-g8bbk1

Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) (Yeast) (Monilia parapsilosis). Uncharacterized protein

Relationship
Family|Arb2_domain
Block| X
Position in NCBI Life Tree|Candida parapsilosis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Debaryomycetaceae: N E > Candida/Lodderomyces clade: N E > Candida [Debaryomycetaceae]: N E > Candida parapsilosis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : HE605205
1 UniProt : G8BBK1
1 UniProt : G8BBK1
1 Interpro : G8BBK1
1 Pfam : G8BBK1
1 PIRSF : G8BBK1
1 SUPERFAM : G8BBK1
Sequence
Graphical view for this peptide sequence: canpc-g8bbk1
Colored MSA for Arb2_domain (raw)
ISDPIRFYQNNEAYTKKQFINLPIINHDKGDKKTANFTCDLPQQIDELIM
ASREIYDCTSIVLTIHDPPEIWANINPTTGIIESNSSILLEQPLFQIMDK
VEKEKDSDNKDKIGYIDINVPSFQLPIPGLSTSHESSYNPTIFAQEVLLY
VWDNYISFFTKLKKLVFVGFGDSYQSIVHLFSKRPSADIKSLVKFTIAYV
NRTPLKPINPVMDESMVDWFYHNSTIFTSHLNSCWSGSSNGSSSESNGDD
LKRPRRKFGRVLKAKGDGLFDVINEKFDEGVDNILDSIEEYSSSEE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

ISDPIRFYQNNEAYTKKQFINLPIINHDKGDKKTANFTCDLPQQIDELIM
ASREIYDCTSIVLTIHDPPEIWANINPTTGIIESNSSILLEQPLFQIMDK
VEKEKDSDNKDKIGYIDINVPSFQLPIPGLSTSHESSYNPTIFAQEVLLY
VWDNYISFFTKLKKLVFVGFGDSYQSIVHLFSKRPSADIKSLVKFTIAYV
NRTPLKPINPVMDESMVDWFYHNSTIFTSHLNSCWSGSSNGSSSESNGDD
LKRPRRKFGRVLKAKGDGLFDVINEKFDEGVDNILDSIEEYSSSEE


References
    Title: Using RNA-seq to determine the transcriptional landscape and the hypoxic response of the pathogenic yeast Candida parapsilosis
    Guida A, Lindstadt C, Maguire SL, Ding C, Higgins DG, Corton NJ, Berriman M, Butler G
    Ref: BMC Genomics, 12:628, 2011 : PubMed

            

    Title: Evolution of pathogenicity and sexual reproduction in eight Candida genomes
    Butler G, Rasmussen MD, Lin MF, Santos MA, Sakthikumar S, Munro CA, Rheinbay E, Grabherr M, Forche A and Cuomo CA <41 more author(s)>
    Ref: Nature, 459:657, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer