Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: canru-1lipa

Candida rugosa (Diutina rugosa) (Yeast) lipase 1 precursor

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Candida rugosa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetales incertae sedis: N E > Diutina: N E > Diutina rugosa: N E


Molecular evidence
Database
No mutation
8 structures (e.g. : 1CRL, 1LPM, 1LPN... more)
No kinetic





2 substrates: Benzyl-butyl-phthalate, Retinol-palmitate
4 inhibitors (e.g. : (Rc,RpSp)-3, 1-dodecanesulfonyl-chloride, 1-hexadecanesulfonyl-chloride... more)
1 Genbank : X64703
1 UniProt : P20261
1 Ncbi-nid : 2544
>3 Structure links 5 more: 1CRL, 1LPM, 1LPN
1 UniProt : P20261
1 Interpro : P20261
1 Prodom : P20261
1 Pfam : P20261
1 PIRSF : P20261
1 SUPERFAM : P20261
Sequence
Graphical view for this peptide sequence: canru-1lipa
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MELALALSLIASVAAAPTATLANGDTITGLNAIINEAFLGIPFAEPPVGN
LRFKDPVPYSGSLDGQKFTSYGPSCMQQNPEGTYEENLPKAALDLVMQSK
VFEAVSPSSEDCLTINVVRPPGTKAGANLPVMLWIFGGGFEVGGTSTFPP
AQMITKSIAMGKPIIHVSVNYRVSSWGFLAGDEIKAEGSANAGLKDQRLG
MQWVADNIAAFGGDPTKVTIFGESAGSMSVMCHILWNDGDNTYKGKPLFR
AGIMQSGAMVPSDAVDGIYGNEIFDLLASNAGCGSASDKLACLRGVSSDT
LEDATNNTPGFLAYSSLRLSYLPRPDGVNITDDMYALVREGKYANIPVII
GDQNDEGTFFGTSSLNVTTDAQAREYFKQSFVHASDAEIDTLMTAYPGDI
TQGSPFDTGILNALTPQFKRISAVLGDLGFTLARRYFLNHYTGGTKYSFL
SKQLSGLPVLGTFHSNDIVFQDYLLGSGSLIYNNAFIAFATDLDPNTAGL
LVKWPEYTSSSQSGNNLMMINALGLYTGKDNFRTAGYDALFSNPPSFFV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MELALALSLIASVAAAPTATLANGDTITGLNAIINEAFLGIPFAEPPVGN
LRFKDPVPYSGSLDGQKFTSYGPSCMQQNPEGTYEENLPKAALDLVMQSK
VFEAVSPSSEDCLTINVVRPPGTKAGANLPVMLWIFGGGFEVGGTSTFPP
AQMITKSIAMGKPIIHVSVNYRVSSWGFLAGDEIKAEGSANAGLKDQRLG
MQWVADNIAAFGGDPTKVTIFGESAGSMSVMCHILWNDGDNTYKGKPLFR
AGIMQSGAMVPSDAVDGIYGNEIFDLLASNAGCGSASDKLACLRGVSSDT
LEDATNNTPGFLAYSSLRLSYLPRPDGVNITDDMYALVREGKYANIPVII
GDQNDEGTFFGTSSLNVTTDAQAREYFKQSFVHASDAEIDTLMTAYPGDI
TQGSPFDTGILNALTPQFKRISAVLGDLGFTLARRYFLNHYTGGTKYSFL
SKQLSGLPVLGTFHSNDIVFQDYLLGSGSLIYNNAFIAFATDLDPNTAGL
LVKWPEYTSSSQSGNNLMMINALGLYTGKDNFRTAGYDALFSNPPSFFV


References
6 more
    Title: Insights into the molecular basis of chiral acid recognition by Candida rugosa lipase from an X-ray crystal structure of a bound phosphonate transition state analog
    Colton IJ, Yin DT, Grochulski P, Kazlauskas RJ
    Ref: Adv Synth Catal, 353:2529, 2011 : PubMed

            

    Title: Two conformational states of Candida rugosa lipase
    Grochulski P, Li Y, Schrag JD, Cygler M
    Ref: Protein Science, 3:82, 1994 : PubMed

            

    Title: Insights into interfacial activation from an open structure of Candida rugosa lipase
    Grochulski P, Li Y, Schrag JD, Bouthillier F, Smith P, Harrison D, Rubin B, Cygler M
    Ref: Journal of Biological Chemistry, 268:12843, 1993 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer