Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: clals-a0a202gac7

Clavispora lusitaniae (Candida lusitaniae). Putative histone deacetylase

Comment
Other strains: Clavispora lusitaniae (strain ATCC 42720) (Yeast) (Candida lusitaniae). Uncharacterized protein


Relationship
Family|Arb2_domain
Block| X
Position in NCBI Life Tree|Clavispora lusitaniae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Metschnikowiaceae: N E > Clavispora: N E > Clavispora lusitaniae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : LYUB02000004, CH408080, XP_002615435.1
2 UniProt : A0A202GAC7, C4Y7Y9
2 UniProt : A0A202GAC7, C4Y7Y9
2 Interpro : A0A202GAC7, C4Y7Y9
2 Pfam : A0A202GAC7, C4Y7Y9
2 PIRSF : A0A202GAC7, C4Y7Y9
2 SUPERFAM : A0A202GAC7, C4Y7Y9
Sequence
Graphical view for this peptide sequence: clals-a0a202gac7
Colored MSA for Arb2_domain (raw)
LAEPVRAHQAAELFARHGFVPLPVLPDGFSEMPPHADELVLASPDIADCP
TVMVCVHDPPEVWADVNAVSGTIESGSSVILEHPLARIMARMSAESDEKI
GYIDICIPEGYGVFAQELLLWVWDNYVSYFSAKKALFVGYGDAHQAVVHL
LAKRPANELREVVRASVAFVNASPLKPLVPVMDESMVDWYYQNSLIFASR
TNACWAGAKDEDKRPRKKFGRVLKAAGDGLWEVIHERFDEGVDFLLDSVG
DFSDSE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

LAEPVRAHQAAELFARHGFVPLPVLPDGFSEMPPHADELVLASPDIADCP
TVMVCVHDPPEVWADVNAVSGTIESGSSVILEHPLARIMARMSAESDEKI
GYIDICIPEGYGVFAQELLLWVWDNYVSYFSAKKALFVGYGDAHQAVVHL
LAKRPANELREVVRASVAFVNASPLKPLVPVMDESMVDWYYQNSLIFASR
TNACWAGAKDEDKRPRKKFGRVLKAAGDGLWEVIHERFDEGVDFLLDSVG
DFSDSE


Reference
    Title: Evolution of pathogenicity and sexual reproduction in eight Candida genomes
    Butler G, Rasmussen MD, Lin MF, Santos MA, Sakthikumar S, Munro CA, Rheinbay E, Grabherr M, Forche A and Cuomo CA <41 more author(s)>
    Ref: Nature, 459:657, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer