Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: leibr-a4h9b6

Leishmania braziliensis Putative uncharacterized protein

Comment
only central part Pfam A DUF726 757 1007


Relationship
Family|Duf_726
Block| X
Position in NCBI Life Tree|Leishmania braziliensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Euglenozoa: N E > Kinetoplastida: N E > Trypanosomatidae: N E > Leishmaniinae: N E > Leishmania [genus]: N E > Viannia: N E > Leishmania braziliensis species complex: N E > Leishmania braziliensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AM494955
1 UniProt : A4H9B6
1 UniProt : A4H9B6
1 Interpro : A4H9B6
1 Pfam : A4H9B6
1 PIRSF : A4H9B6
1 SUPERFAM : A4H9B6
Sequence
Graphical view for this peptide sequence: leibr-a4h9b6
Colored MSA for Duf_726 (raw)
VSGYSAIFDPRRPMRDQQVGLWQSVLHRCALFGSMEPYVLQWEDNYLMQF
GETIQVNLDIADKVARKAVGMTAKTLLQGSMFSSLHAFWSLMGTFQLPLF
AVWATGVIDNTFATLSNRSAYTGKDLAAALLDQHRGNRPVTLVGFSFGSR
VIVECLRELDKVEAYGVVENVYLMGCPCSSDPRLWRGLRRVVGGRLINVY
TREDWTLWMMYRLNETELKPMAGTSPVNVPGVENVDVTPLVSAHGDYAVK
LLPVL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

VSGYSAIFDPRRPMRDQQVGLWQSVLHRCALFGSMEPYVLQWEDNYLMQF
GETIQVNLDIADKVARKAVGMTAKTLLQGSMFSSLHAFWSLMGTFQLPLF
AVWATGVIDNTFATLSNRSAYTGKDLAAALLDQHRGNRPVTLVGFSFGSR
VIVECLRELDKVEAYGVVENVYLMGCPCSSDPRLWRGLRRVVGGRLINVY
TREDWTLWMMYRLNETELKPMAGTSPVNVPGVENVDVTPLVSAHGDYAVK
LLPVL


Reference
    Title: Comparative genomic analysis of three Leishmania species that cause diverse human disease
    Peacock CS, Seeger K, Harris D, Murphy L, Ruiz JC, Quail MA, Peters N, Adlem E, Tivey A and Berriman M <32 more author(s)>
    Ref: Nat Genet, 39:839, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer