Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: picgu-a5dks8

Meyerozyma guilliermondii (Yeast) (Candida guilliermondii); Meyerozyma sp.. Uncharacterized protein

Comment
Other strains: Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii); Meyerozyma sp. JA9


Relationship
Family|Arb2_domain
Block| X
Position in NCBI Life Tree|Meyerozyma guilliermondii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Debaryomycetaceae: N E > Meyerozyma: N E > Meyerozyma guilliermondii: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CH408158, XP_001484498.1
1 UniProt : A5DKS8
2 UniProt : A5DKS8, A0A421J3X5
2 Interpro : A5DKS8, A0A421J3X5
2 Pfam : A5DKS8, A0A421J3X5
2 PIRSF : A5DKS8, A0A421J3X5
2 SUPERFAM : A5DKS8, A0A421J3X5
Sequence
Graphical view for this peptide sequence: picgu-a5dks8
Colored MSA for Arb2_domain (raw)
IRSHQANELFEKYNFVNLPIVTAATADTKSSYFTDMPSRKDDLILASPDI
YNAETLVVTIHDPHEIWANIEPNSGTIDGGSSVVLEHPMVQIMEKVKSEL
AESSEPSNEKLGFMDIEIPSLALPSKPIGSLANPSVSTYSPTIFSQELLL
YVWDNYITYFSNIKKIVFVGFGDAYQAIVHLYSKRPPQEIKEVVKGTIAF
AAKSPLKPLVSVMDESMVDWYYQNSVVFTSHLNSCWTSTGSGRAADSADE
NKRPRRKFGRVLKSGSDNLWDVISDKFNEGIDFVLDSIEDLSGTEESS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

IRSHQANELFEKYNFVNLPIVTAATADTKSSYFTDMPSRKDDLILASPDI
YNAETLVVTIHDPHEIWANIEPNSGTIDGGSSVVLEHPMVQIMEKVKSEL
AESSEPSNEKLGFMDIEIPSLALPSKPIGSLANPSVSTYSPTIFSQELLL
YVWDNYITYFSNIKKIVFVGFGDAYQAIVHLYSKRPPQEIKEVVKGTIAF
AAKSPLKPLVSVMDESMVDWYYQNSVVFTSHLNSCWTSTGSGRAADSADE
NKRPRRKFGRVLKSGSDNLWDVISDKFNEGIDFVLDSIEDLSGTEESS


Reference
    Title: Evolution of pathogenicity and sexual reproduction in eight Candida genomes
    Butler G, Rasmussen MD, Lin MF, Santos MA, Sakthikumar S, Munro CA, Rheinbay E, Grabherr M, Forche A and Cuomo CA <41 more author(s)>
    Ref: Nature, 459:657, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer