Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pseae-PA0502

Pseudomonas aeruginosa (and strains UCBPP-PA14; PA7; LESB58; C3719; 2192;) probable biotin biosynthesis protein bioh

Comment
In Pseudomonas aeruginosa the bioH gene is within a biotin synthesis operon and its transcription is coregulated with the other biotin operon genes. In Escherichia coli the gene is not located within a biotin synthetic operon and its transcription is not coregulated with the other biotin synthesis genes


Relationship
Family|BioH
Block| X
Position in NCBI Life Tree|Pseudomonas aeruginosa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas aeruginosa group: N E > Pseudomonas aeruginosa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: AE004487, CP000438, CP000744
1 UniProt : A6UYW2
2 UniProt : Q9I616, A6UYW2
2 Interpro : Q9I616, A6UYW2
2 Prodom : Q9I616, A6UYW2
2 Pfam : Q9I616, A6UYW2
2 PIRSF : Q9I616, A6UYW2
2 SUPERFAM : Q9I616, A6UYW2
Sequence
Graphical view for this peptide sequence: pseae-PA0502
Colored MSA for BioH (raw)
MRDHLILLPGWGLGSAPLEPLRDALHEREPHLNVLIEPLPSLDDAADWLD
ELDDNLPRDSWLAGWSLGGMLAGELAARRGDDCRGLLTLASNPCFRVRED
WPNAMPAETFEDFFEAFLLEPHLTRKRFTLLVSQGARDPRTLARQLQVAL
PQLEREALVAGLQLLGQLDTRAALENFRGPQLHLFAEADALVPLAAAEAL
LEWLPDVEVSTLAASHGLPLECPDEVAGAILRFLREGDDA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRDHLILLPGWGLGSAPLEPLRDALHEREPHLNVLIEPLPSLDDAADWLD
ELDDNLPRDSWLAGWSLGGMLAGELAARRGDDCRGLLTLASNPCFRVRED
WPNAMPAETFEDFFEAFLLEPHLTRKRFTLLVSQGARDPRTLARQLQVAL
PQLEREALVAGLQLLGQLDTRAALENFRGPQLHLFAEADALVPLAAAEAL
LEWLPDVEVSTLAASHGLPLECPDEVAGAILRFLREGDDA


References
2 more
    Title: Expression and Activity of the BioH Esterase of Biotin Synthesis is Independent of Genome Context
    Cao X, Zhu L, Hu Z, Cronan JE
    Ref: Sci Rep, 7:2141, 2017 : PubMed

            

    Title: Genomic analysis reveals that Pseudomonas aeruginosa virulence is combinatorial
    Lee DG, Urbach JM, Wu G, Liberati NT, Feinbaum RL, Miyata S, Diggins LT, He J, Saucier M and Ausubel FM <7 more author(s)>
    Ref: Genome Biol, 7:R90, 2006 : PubMed

            

    Title: Complete genome sequence of Pseudomonas aeruginosa PAO1, an opportunistic pathogen
    Stover CK, Pham XQ, Erwin AL, Mizoguchi SD, Warrener P, Hickey MJ, Brinkman FS, Hufnagle WO, Kowalik DJ and Olson MV <21 more author(s)>
    Ref: Nature, 406:959, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer