Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: thema-TM0033

Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)a EstA hypothetical 44.8 kda protein

Comment
Novel Thermostable Esterase Containing an N-terminal Immunoglobulin-Like Domain


Relationship
Family|5_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Thermotoga maritima
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Thermotogae [phylum]: N E > Thermotogae [class]: N E > Thermotogales: N E > Thermotogaceae: N E > Thermotoga: N E > Thermotoga maritima: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 3DOH, 3DOI
No kinetic





No Substrate
1 inhbitor:
Paraoxon
3 Genbank : AE000512, AAD35127, AGL48956
1 UniProt : Q9WXP0
2 Structure : 3DOH, 3DOI
1 UniProt : Q9WXP0
1 Interpro : Q9WXP0
1 Prodom : Q9WXP0
1 Pfam : Q9WXP0
1 PIRSF : Q9WXP0
1 SUPERFAM : Q9WXP0
Sequence
Graphical view for this peptide sequence: thema-TM0033
Colored MSA for 5_AlphaBeta_hydrolase (raw)
MLFFIFMGILSILFAQEDVTVKSVTLITKVFPEGEKVCAVVIEYPVEIDG
QKLSPDQFSVKVKTGDTYSSRTITKVYANNSGGLSFSIFNNRGKYVVLEL
STEDLHSNTIVFGPNFLNTRMKLDYIVSQLVPIFDVDGNEVEPFTSKQTD
EKHLIIDDFLAFTFKDPETGVEIPYRLFVPKDVNPDRKYPLVVFLHGAGE
RGTDNYLQVAGNRGAVVWAQPRYQVVHPCFVLAPQCPPNSSWSTLFTDRE
NPFNPEKPLLAVIKIIRKLLDEYNIDENRIYITGLSMGGYGTWTAIMEFP
ELFAAAIPICGGGDVSKVERIKDIPIWVFHAEDDPVVPVENSRVLVKKLA
EIGGKVRYTEYEKGFMEKHGWDPHGSWIPTYENQEAIEWLFEQSR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLFFIFMGILSILFAQEDVTVKSVTLITKVFPEGEKVCAVVIEYPVEIDG
QKLSPDQFSVKVKTGDTYSSRTITKVYANNSGGLSFSIFNNRGKYVVLEL
STEDLHSNTIVFGPNFLNTRMKLDYIVSQLVPIFDVDGNEVEPFTSKQTD
EKHLIIDDFLAFTFKDPETGVEIPYRLFVPKDVNPDRKYPLVVFLHGAGE
RGTDNYLQVAGNRGAVVWAQPRYQVVHPCFVLAPQCPPNSSWSTLFTDRE
NPFNPEKPLLAVIKIIRKLLDEYNIDENRIYITGLSMGGYGTWTAIMEFP
ELFAAAIPICGGGDVSKVERIKDIPIWVFHAEDDPVVPVENSRVLVKKLA
EIGGKVRYTEYEKGFMEKHGWDPHGSWIPTYENQEAIEWLFEQSR


References
    Title: Crystal structure and biochemical properties of a novel thermostable esterase containing an immunoglobulin-like domain
    Levisson M, Sun L, Hendriks S, Swinkels P, Akveld T, Bultema JB, Barendregt A, van den Heuvel RH, Dijkstra BW and Kengen SW <1 more author(s)>
    Ref: Journal of Molecular Biology, 385:949, 2009 : PubMed

            

    Title: Crystallization and preliminary crystallographic analysis of an esterase with a novel domain from the hyperthermophile Thermotoga maritima
    Sun L, Levisson M, Hendriks S, Akveld T, Kengen SW, Dijkstra BW, Van der Oost J
    Ref: Acta Crystallographica Sect F Struct Biol Cryst Commun, 63:777, 2007 : PubMed

            

    Title: Evidence for lateral gene transfer between Archaea and bacteria from genome sequence of Thermotoga maritima
    Nelson KE, Clayton RA, Gill SR, Gwinn ML, Dodson RJ, Haft DH, Hickey EK, Peterson JD, Nelson WC and Fraser CM <19 more author(s)>
    Ref: Nature, 399:323, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer