Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: trede-q73nf8

Treponema denticola prolyl endopeptidase (EC 3.4.21.26)

Relationship
Family|S9N_PPCE_Peptidase_S9
Block| X
Position in NCBI Life Tree|Treponema denticola
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Spirochaetes: N E > Spirochaetia: N E > Spirochaetales: N E > Spirochaetaceae: N E > Treponema: N E > Treponema denticola: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AE017250
1 UniProt : Q73NF8
1 UniProt : Q73NF8
1 Interpro : Q73NF8
1 Pfam : Q73NF8
1 PIRSF : Q73NF8
1 SUPERFAM : Q73NF8
Sequence
Graphical view for this peptide sequence: trede-q73nf8
Colored MSA for S9N_PPCE_Peptidase_S9 (raw)
MQYKKSDVSDNYFGTIVPDPYRWLEDDNAPEVIAWVKEENKKTEDFLSKI
SFRGELKKRLEEIWDYEKRSGLFKAGNFYYFFRTEGLQNQSIMCRQSGNI
KAESSPEVFFDPNKLSADGTTALKNLAFSKDGKYMAYSVSGSGSDWEEIF
VFDAEKKADTGEHIHWVKFSNIAWYKDGFFYSSYDTPDKGKSLTEKNEFQ
KLKYHKLGTKESDDLLIFEDKDHPLRSFSASTTEDEKTLLLTAFEVGSEG
NMLFVADLSEGLPKCSHCFKQYNTHFNDSVWPLETENGFLYLLTNKQAPF
YRVVKTSLNNISEKSIDEVIPQKDCLLSSAALCGGKLLTVYLRDVQDEAF
ICGLDGKNSTKINLPANGSISFSGTRKNEDSLFFNFTSYTTPNKIIRYDI
KTNSLTDFFVPAIPINTGDFKCEQVFFKSKDGTKIPMHIVSKKDIKLDGS
NPTIMYGYGGFAISLPPAFSAARMAFLEKGGIFACVNLRGGLEYGEAWHS
AGKKMKKQNVFDDFIAAGEYLIEHKYTSSKKLAIQGGSNGGLLIGAVTNQ
RPDLFAVAIPQVGVLDMLRYQHFTIGWAWVDEYGSSEDSKEMFEYLYAYS
PLHNVKEGVNYPSIMVCTGDHDDRVVPAHSFKYAQALHDTYKGENPILIR
ITEKAGHGAGKPTAKIIEETADIYAFIFKQTGHII
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQYKKSDVSDNYFGTIVPDPYRWLEDDNAPEVIAWVKEENKKTEDFLSKI
SFRGELKKRLEEIWDYEKRSGLFKAGNFYYFFRTEGLQNQSIMCRQSGNI
KAESSPEVFFDPNKLSADGTTALKNLAFSKDGKYMAYSVSGSGSDWEEIF
VFDAEKKADTGEHIHWVKFSNIAWYKDGFFYSSYDTPDKGKSLTEKNEFQ
KLKYHKLGTKESDDLLIFEDKDHPLRSFSASTTEDEKTLLLTAFEVGSEG
NMLFVADLSEGLPKCSHCFKQYNTHFNDSVWPLETENGFLYLLTNKQAPF
YRVVKTSLNNISEKSIDEVIPQKDCLLSSAALCGGKLLTVYLRDVQDEAF
ICGLDGKNSTKINLPANGSISFSGTRKNEDSLFFNFTSYTTPNKIIRYDI
KTNSLTDFFVPAIPINTGDFKCEQVFFKSKDGTKIPMHIVSKKDIKLDGS
NPTIMYGYGGFAISLPPAFSAARMAFLEKGGIFACVNLRGGLEYGEAWHS
AGKKMKKQNVFDDFIAAGEYLIEHKYTSSKKLAIQGGSNGGLLIGAVTNQ
RPDLFAVAIPQVGVLDMLRYQHFTIGWAWVDEYGSSEDSKEMFEYLYAYS
PLHNVKEGVNYPSIMVCTGDHDDRVVPAHSFKYAQALHDTYKGENPILIR
ITEKAGHGAGKPTAKIIEETADIYAFIFKQTGHII


Reference
    Title: Comparison of the genome of the oral pathogen Treponema denticola with other spirochete genomes
    Seshadri R, Myers GS, Tettelin H, Eisen JA, Heidelberg JF, Dodson RJ, Davidsen TM, DeBoy RT, Fouts DE and Paulsen IT <29 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:5646, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer