Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: wheat-w5d1z6

Triticum aestivum (Wheat), Triticum urartu (Red wild einkorn) (Crithodium urartu) Uncharacterized protein

Comment
Other strains: Triticum aestivum (Wheat), Triticum urartu (Red wild einkorn) (Crithodium urartu)


Relationship
Family|Pectinacetylesterase-Notum
Block| X
Position in NCBI Life Tree|Triticum aestivum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Pooideae: N E > Triticodae: N E > Triticeae: N E > Triticinae: N E > Triticum: N E > Triticum aestivum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : HG670306
2 UniProt : T1LAX4, A0A080YUW0
2 UniProt : T1LAX4, A0A080YUW0
2 Interpro : T1LAX4, A0A080YUW0
2 Prodom : T1LAX4, A0A080YUW0
2 Pfam : T1LAX4, A0A080YUW0
2 PIRSF : T1LAX4, A0A080YUW0
2 SUPERFAM : T1LAX4, A0A080YUW0
Sequence
Graphical view for this peptide sequence: wheat-w5d1z6
Colored MSA for Pectinacetylesterase-Notum (raw)
MDMVPASAEPLLHMEQRQLRPSHHGGWWGLAAAALLLMLLVTVGPLRPML
FGVPLPEPVALTLLTGAQEKGAVCLDGTPPGYHLQRGSGDGSSSWHIHLQ
GGGWCGTVNDCSNRRMSDLGSSKFMKPIQFAGTGILGSDHLQNPDFYNWN
KAYVRYCDGASFSGDAEGQAQDGTILHFRGLRIYQAVIDELMENGLANAT
QAILTGCSAGGLATIVHCDDFSARFSHKVSVKCLVDAGFILDVKDISGQR
SFRSLYGGVVHLQNVRQVLPKDCLTNKEPTECFFPAELIKSIHTPMFIVN
SGYDPAQIRNVIVPASSAPDKSWLSCKDNIRNCNSTQIDVLDGLRTTMAD
ALKVVKDKEDWGFFIDSCFTHCQTVLDVSWNSHNSPRLGNKTVAEAVGDW
HRGRTQGVKEVDCKYPCNPTCNSQSPL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDMVPASAEPLLHMEQRQLRPSHHGGWWGLAAAALLLMLLVTVGPLRPML
FGVPLPEPVALTLLTGAQEKGAVCLDGTPPGYHLQRGSGDGSSSWHIHLQ
GGGWCGTVNDCSNRRMSDLGSSKFMKPIQFAGTGILGSDHLQNPDFYNWN
KAYVRYCDGASFSGDAEGQAQDGTILHFRGLRIYQAVIDELMENGLANAT
QAILTGCSAGGLATIVHCDDFSARFSHKVSVKCLVDAGFILDVKDISGQR
SFRSLYGGVVHLQNVRQVLPKDCLTNKEPTECFFPAELIKSIHTPMFIVN
SGYDPAQIRNVIVPASSAPDKSWLSCKDNIRNCNSTQIDVLDGLRTTMAD
ALKVVKDKEDWGFFIDSCFTHCQTVLDVSWNSHNSPRLGNKTVAEAVGDW
HRGRTQGVKEVDCKYPCNPTCNSQSPL


References
    Title: Structural and functional partitioning of bread wheat chromosome 3B
    Choulet F, Alberti A, Theil S, Glover N, Barbe V, Daron J, Pingault L, Sourdille P, Couloux A and Feuillet C <21 more author(s)>
    Ref: Science, 345:1249721, 2014 : PubMed

            

    Title: Draft genome of the wheat A-genome progenitor Triticum urartu
    Ling HQ, Zhao S, Liu D, Wang J, Sun H, Zhang C, Fan H, Li D, Dong L and Zhang A <39 more author(s)>
    Ref: Nature, 496:87, 2013 : PubMed

            

    Title: Analysis of the bread wheat genome using whole-genome shotgun sequencing
    Brenchley R, Spannagl M, Pfeifer M, Barker GL, D'Amore R, Allen AM, McKenzie N, Kramer M, Kerhornou A and Hall N <19 more author(s)>
    Ref: Nature, 491:705, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer