Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: xentr-f6rff6

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uncharacterized protein

Relationship
Family|ABHD6-Lip
Block| X
Position in NCBI Life Tree|Xenopus tropicalis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amphibia: N E > Batrachia: N E > Anura: N E > Pipoidea: N E > Pipidae: N E > Xenopodinae: N E > Xenopus [genus]: N E > Silurana: N E > Xenopus tropicalis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AAMC01040736, AAMC01040737, AAMC01040738
1 UniProt : F6RFF6
1 UniProt : F6RFF6
1 Interpro : F6RFF6
1 Prodom : F6RFF6
1 Pfam : F6RFF6
1 PIRSF : F6RFF6
1 SUPERFAM : F6RFF6
Sequence
Graphical view for this peptide sequence: xentr-f6rff6
Colored MSA for ABHD6-Lip (raw)
MDIDVLNMFLVAGGTLLVPILAFVTSFLLWPAALINIYYWYWRRALGMQV
KYSSYGNYQFCYTSRGKPGNKPSVLMLHGFSAHKDMWLSVVKFLPKNLHL
VCVDMPGHEGTTRSPLDDYSISGQVKRIHQFVESIGLNKKPFHLVGTSMG
GNVAGVYAAQYPTDISSLTLICPAGLDYPNDSTFLKHLKGLEKSSPDDQR
IPLIPSTATEMQEMLRLCSFVRFKIPQQVLQGLVDVRIPHNEFYRRLFLA
LVDEKSRHSLHENMGKIVAPTQIIWGKQDQVLDVSGTEVLAGSIRGCQVE
ILENCGHSVVMERPRKSAKLMTDFLSSLQSTENNKKHD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDIDVLNMFLVAGGTLLVPILAFVTSFLLWPAALINIYYWYWRRALGMQV
KYSSYGNYQFCYTSRGKPGNKPSVLMLHGFSAHKDMWLSVVKFLPKNLHL
VCVDMPGHEGTTRSPLDDYSISGQVKRIHQFVESIGLNKKPFHLVGTSMG
GNVAGVYAAQYPTDISSLTLICPAGLDYPNDSTFLKHLKGLEKSSPDDQR
IPLIPSTATEMQEMLRLCSFVRFKIPQQVLQGLVDVRIPHNEFYRRLFLA
LVDEKSRHSLHENMGKIVAPTQIIWGKQDQVLDVSGTEVLAGSIRGCQVE
ILENCGHSVVMERPRKSAKLMTDFLSSLQSTENNKKHD


Reference
    Title: The genome of the Western clawed frog Xenopus tropicalis
    Hellsten U, Harland RM, Gilchrist MJ, Hendrix D, Jurka J, Kapitonov V, Ovcharenko I, Putnam NH, Shu S and Rokhsar DS <38 more author(s)>
    Ref: Science, 328:633, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer