betvv-a0a0j8b442

Beta vulgaris subsp. vulgaris (Beet). Lipase_3 domain-containing protein

Comment

Relationship

Family : Triacylglycerol-lipase-OBL1-like

Block : L

Position in NCBI Life Tree : Beta vulgaris subsp. vulgaris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MATNELASCNHVNLLPDKNKATFRNFFKNLCFNRHISETE
LLDHNCYEDE EIKILHRGMIFLSMFIQISLKHMSKPMKI
CRSFIEGFLNRGVTQRESVKY YSFLGHSDYRLDLSKDIK
HEDARYYPALTVMASKLSYENKAVIRTAVTDH WKMEFVD
FYNFYNEYQRKLTTQAFIFRERNADGDRIIVAFRGTSPFV
ADD WSTDFDFSWLKIGGMGKTHMGFMIALGLQKFSREDD
DYYGDFSGSWPKEV DQHPQQPLAYYTIREKLKELLGDDK
NAKIIVTGHSLGGALAILFPAVLAF HGEVELLNRLEGIY
TYGQPRVGDREFGEFMKKNLREHKIKYYRIVYNYDL VTK
VPLDDALMTFKHFGKCIVFNSLYHGKVVKEEEERSGNIIL
RIMKLII VTLFNFIVARLTAVWELIRGFFIGLVKGPEYK
EGWMLTFLRVTGIFLPSI VNHFPQDYVNSTRLASEDLFK
VCPALL

References