betvu-a0a0j8bcg5

Beta vulgaris subsp. vulgaris. Uncharacterized protein

Comment

Relationship

Family : Chlorophyllase_Plant

Block : L

Position in NCBI Life Tree : Beta vulgaris subsp. vulgaris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MSSPSSSTNDTTSNFITIFDNGTYSTVLLNIKAEDFSSDS
KTTSPSKPLI IATPSCSEGGEFPVLLMLHGYILYNHFYS
QLIKHIASHGFVVIAPQLYTI AGADSSDEIKDTAAIIDW
ASKSLKNVLPSNVRPNLDKLALSGHSRGGKVA FALALKK
VTTSPLKISALIGIDPVDGMGKKNQTPPPVLTHLPQSFKL
DGM PVLVIGSGFGAIKKNPLFPPCAPEGVNHENFYNESQ
NPAWYFLVKDYGHL DMLDDCTKGVRGVSTYCLCKNGQSR
EPMRKFVGGVIVAFLNAYLKADESM LVSIRDGEETIPVK
FDKVDVRL

References