spiol-a0a0k9riw3

Spinacia oleracea (Spinach). Uncharacterized protein

Comment

Relationship

Family : Chlorophyllase_Plant

Block : L

Position in NCBI Life Tree : Spinacia oleracea

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVALWFGVLILRVLAVVHSEAQLLLPTTFSENLSVFHKGK
LAVSEPIKVR NSAYSSPQQLLIVSPKEAGLYPVLLFIHG
TMISNDDYSDLFLHIASHAFI VVAPQLFSVFNLPSQAQE
IEMAATVANWLPSNLQHVLHERVNKQVEPNLD KLALSGH
SRGGKSAFALALGLSKTKLSLKISALIGVDPVEGRNKNKR
TRP YVLTYEPNSFNLSIPVTIIGTGLGNHTKLLNPACAP
NGVNHQEFFNECNK ECSHFVIMEYGHMQMLNDVLDALAI
SMSRVCASKRGSNSIMRRTLGGVMV AFLGAYFGDEGGQY
FAILDNPSLAPTKLYANNKGILGLAPSYAL

References