betvu-a0a0j8fqe7

Beta vulgaris subsp. vulgaris. Uncharacterized protein

Comment

Relationship

Family : Chlorophyllase_Plant

Block : L

Position in NCBI Life Tree : Beta vulgaris subsp. vulgaris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MGSLWVSISIIMILMLTILDYSEAEFSTTTPSFLQESISQ
YDNSHVSEKL TVFETGKHQVTNPILVRKSQYSTPEPLLI
ISPKEAGSYPVLFFIHGTLIS NQDYSHLFKHVASHGFIV
VAPLLFRPLVIFPPSQADEIEMAASMINWLPS KLHEVLR
DRVNAKVSADLQKVAISGHSRGGKSAFALALGMSKTKLNF
NIS ALIGVDPVAGPDNHSQTEPHVLTYIDNSFDLSIPCT
VIGTGLGSKRNRLI PPCAPSNVSHQQFFNELKQGSHFVI
EKYGHMQMLNDFLTDPVAVSMSVMC TSGFGPKTTMRRTL
GGIMVAFLDAYFRDEKQQFFTLMANPSLAPTKLSVE KKG
KFRFAPTNAQQL

References