spiol-a0a0k9qe58

Spinacia oleracea (Spinach). Abhydrolase_3 domain-containing protein

Comment

Relationship

Family : Plant_carboxylesterase

Block : H

Position in NCBI Life Tree : Spinacia oleracea

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MSVIAEAPDFLQVFSDGTVKRFSPEIAIASPESSESYKSK
DIVIDSSKPI TGRIFLPNTPTINTSTHKLPVVVYFHGGG
FCIGSTTWLNYHIFLGDLASL TGAIVLSIDYRLAPEYPL
PIAYSDGCSSLEWLIKSCYTEPWLQRADLSRV FLSGDSA
GGNIAHNITMKVAHISEEHDFSGIKIEGILLIHPYFGSEE
RTP QEMIDESGVEVQMNDMFWKLSIPQGSNRDYFGCNFE
KVGFKDKEWDVFPR VVVYVAGLDFLKERGVMYVEYLKTK
GVRDVKLIEAKDQGHIYHVYHPNSE STLLLQHQMKEFIY
NF

References