spiol-a0a0k9rrd8

Spinacia oleracea (Spinach). protein bem46-like

Comment

Relationship

Family : ABHD13-BEM46

Block : X

Position in NCBI Life Tree : Spinacia oleracea

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVLYMNALLYGVGGIVVAGMALLVAFQERLVYVPVLPGLT
KSYPITPARL RLLYEDVWLRSEDGVKLHAWFIQRIPDCR
GPTILFFQENAGNIAHRLEMV RIMIQKLQCNVFMLSYRG
YGASDGSPSQHGITKDAQAALDHLMQRTDIDT SQIIVFG
RSLGGAVGAVLAKNNPDKVSALLLENTFTSILDMAGVLLP
FLK WFIGRSTGNGFKILNCVVRSPWSTIDIIGQVKQPIL
FISGLQDEMVPPTH MKMLYAKAAARNRRCYFVEFPTGMH
MDTWLTGGDRYWRTVNEFMEEHVSV NMHDESNSSSTDSH
AS

References