spiol-a0a0k9rub8

Spinacia oleracea (Spinach). Uncharacterized protein

Comment

Relationship

Family : UCP031088

Block : X

Position in NCBI Life Tree : Spinacia oleracea

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MRPSLQFASIFRRLSPATSNYRHRLAPLTTNYRHHLPLRL
TVRAFSNNAV EKVVNKPSICTADELHYVHVANSDWRLAL
WRYHPNPQARARNHPLLLLSG VGTNAIGYDLSPESSFAR
HMSGQGFDTWILEVRGAGLSMPATNLKDVEQS AHEISSK
IESAAEKAKETAVNKRQSLEVEDEALVGSDVPPNKGAPLT
VST IWDESELVTKLTETFMRISQKLSGFLSEGQSRIMSA
RLFDQLQILLEDSH LLDRFNETREKLSSLLETSDKSSVA
SQITDLSEKLVNIFEESQNSVSPQL FDLQTRFFTTIEEF
QKQLDVMVKYDWDFDHYLEEDIPAVMEYIRAESKPK DGK
LFAIGHSMGGILLYGMLSRCGYEGKDPGLAAVVTLASSLD
YTTSKSS LKMLLPLANPAQILNVPVVPLGAMLSAAYPFS
SSPPYVLSWLNNLISAED MMDPELLKKLVLNNFCTISAK
LLLQLTTALQEGGLRDRSGTFFYKDHLQK NSTPVLALAG
DQDLICPPEAVYDTVKAIPENMVTYKVFGQPGGPHYAHYD
LVGGRLAVEEIYPCIVDFLSCND

References