spiol-a0a0k9rit5

Spinacia oleracea (Spinach). Uncharacterized protein

Comment

Relationship

Family : Chlorophyllase_Plant

Block : L

Position in NCBI Life Tree : Spinacia oleracea

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MDATLWVKLIVSIPGVLAILYYSEAQILPNFLESSTSHKN
YNSEDITIFE NGKFEVTKPIEVEKSKFSAPEPLLVVSPY
QPGLYPILLFVHGTLISNEDY SDLFQRIVSHGFIVVAPK
LFSIFNFPSEEDEIEMVVSVANWLPSNLQDVL HERVGEG
VEGDLNKLAISGHSRGGKSAFGVTLGLSKTKLTVNISALI
GVD PVAGSNKNDRTQPHVLTYVPNSFNLSIPVTIIGTGL
GNQTNFLLPPCAPN YVNHQEFYVECKESSHFVILKYGHM
QMLNDYVDPIASYVSLVCESGDGLK STMRRTVSGIMVAF
LDAYFGDDGGRQYFAILANPSLTPTRVYVEKKGNFG LPR
NHYAQV

References