spiol-a0a0k9rxl0

Spinacia oleracea (Spinach). Uncharacterized protein

Comment

Relationship

Family : UCP031088

Block : X

Position in NCBI Life Tree : Spinacia oleracea

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MKLRAAVVEKPENCTADELHYVTVPNTDWRLALWRYLPSS
NAVNARNHPL LLLSGVGTNAIGYDLSPQTSFARHMSREG
FDTWILEVRGAGFSMRGLESF QGLSKTGQSQVKDSSWNE
KFIPMVGDIQRQLDLFLDSEWDFDQLLKEDLP LVVDYIK
MQSNPQDGKLFAIGHSMGGILLYAALSLCGFEGRQSPFAA
VTT LSSALDYSSSKSSLELLLPLADPAKALKITSIPIGA
LLATMQPLASRAPF LLSWLNSMISAQDMMLPEMFDKFTL
KNFCTVPAKLLLQLATLFESSGLRD RSGTFYYKDHLHKT
NVPILALAGDRDLICPPEAVYETIKVIPEDKITFKV FGE
VGGPHYAHYDLVGGRFAAKKVCPCIIHFLSAHDKLDR

References