spiol-a0a0k9ri52

Spinacia oleracea (Spinach). Lipase_3 domain-containing protein

Comment

Relationship

Family : Triacylglycerol-lipase-OBL1-like

Block : L

Position in NCBI Life Tree : Spinacia oleracea

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MRWTAFLSIFVEIFLKLIAKPLKKLGSIIENFLNSCTQRD
NKDYYSIFGF IDTRFDLDKKIQHGDAKYYPALSMMASKL
AYENQAVVQTTISERWKMDFV DFYNFYNEFKQKSTTQAF
IFHNENIDEDMIVVAFRGTSLFSAEDWSTDFN YAGVKIE
GIPGKTHFGYMLALGLNKYSRDNDNDDYLGNISGTWPKQI
EQD PKRPLAYYTLREKLKEMMSRYENAKIIVTGHSFGGA
LAVLFPAVLALHGE VELLDKLEGIYTYGQPRVGDGHFGH
FMKNNVIREHNIKYYRIVYGYDIVP QLPPRDDAAKSFKH
FGTALRFNSFYHGKVKT

References