brarp-m4dwr7

Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis). Uncharacterized protein

Comment

Relationship

Family : Pectinacetylesterase-Notum

Block : X

Position in NCBI Life Tree : Brassica rapa subsp. pekinensis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

No Genbank

Sequence

Peptide

MEKLKQCWSSLLVLAVVVIGTGAVPITYLQSAVAKGAVCL
DGSAPAYHFD KGFGSGVNNWIVHMEGGGWCTDVASCSAR
KNTMKGSSKFMNKDFGFSGIL GGKQNTNPDFYNWNRIKV
RYCDGSSFTGNVEAVNPANKLFFRGARVWRAV IDDLMAK
GMKNAQNAILSGCSAGALAAILHCDTFRAILPPTARVKCV
SDA GYFIHGTDISGGSYIQTYYSKVVALHGSAKSLPVSC
TSKMKPELCFFPQN VVPSMRTPLFVINAAFDSWQIKNVL
APTAVDKRKEWKNCKLDLKKCTAAQ LKTVQGFRDQMMRA
LSPVHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQ VAN
SKISQAVGNWFYGRSAFQKIDCPSPICNPTCPAISTDE

References

Title : The genome of the mesopolyploid crop species Brassica rapa - Wang_2011_Nat.Genet_43_1035
Author(s) : Wang X , Wang H , Wang J , Sun R , Wu J , Liu S , Bai Y , Mun JH , Bancroft I , Cheng F , Huang S , Li X , Hua W , Freeling M , Pires JC , Paterson AH , Chalhoub B , Wang B , Hayward A , Sharpe AG , Park BS , Weisshaar B , Liu B , Li B , Tong C , Song C , Duran C , Peng C , Geng C , Koh C , Lin C , Edwards D , Mu D , Shen D , Soumpourou E , Li F , Fraser F , Conant G , Lassalle G , King GJ , Bonnema G , Tang H , Belcram H , Zhou H , Hirakawa H , Abe H , Guo H , Jin H , Parkin IA , Batley J , Kim JS , Just J , Li J , Xu J , Deng J , Kim JA , Yu J , Meng J , Min J , Poulain J , Hatakeyama K , Wu K , Wang L , Fang L , Trick M , Links MG , Zhao M , Jin M , Ramchiary N , Drou N , Berkman PJ , Cai Q , Huang Q , Li R , Tabata S , Cheng S , Zhang S , Sato S , Sun S , Kwon SJ , Choi SR , Lee TH , Fan W , Zhao X , Tan X , Xu X , Wang Y , Qiu Y , Yin Y , Li Y , Du Y , Liao Y , Lim Y , Narusaka Y , Wang Z , Li Z , Xiong Z , Zhang Z
Ref : Nat Genet , 43 :1035 , 2011
Abstract : Wang_2011_Nat.Genet_43_1035
ESTHER : Wang_2011_Nat.Genet_43_1035
PubMedSearch : Wang_2011_Nat.Genet_43_1035
PubMedID: 21873998
Gene_locus related to this paper: braol-Q8GTM3 , braol-Q8GTM4 , brarp-m4ei94 , brarp-m4c988 , brana-a0a078j4a9 , brana-a0a078e1m0 , brana-a0a078cd75 , brarp-m4dwa6 , brana-a0a078j4f0 , brana-a0a078cus4 , brana-a0a078f8c2 , brana-a0a078jql1 , brana-a0a078dgj3 , brana-a0a078hw50 , brana-a0a078cuu0 , brana-a0a078dfa9 , brana-a0a078ic91 , brarp-m4ctw3 , brana-a0a078ca65 , brana-a0a078ctc8 , brana-a0a078h021 , brana-a0a078jx23 , brarp-m4da84 , brarp-m4dwr7 , brana-a0a078dh94 , brana-a0a078h612 , brana-a0a078j2t3 , braol-a0a0d3dpb2 , braol-a0a0d3dx76 , brana-a0a078jxa8 , brana-a0a078i2k3 , brarp-m4cwq4 , brarp-m4dcj8 , brarp-m4eh17 , brarp-m4eey4 , brarp-m4dnj8 , brarp-m4ey83 , brarp-m4ey84