cioin-150181

Ciona intestinalis gene ci0100150181

Comment

"ci0100150181" || "differences between F7ANP5 and XM_002121787"

Relationship

Family : Carb_B_Chordata

Block : C

Position in NCBI Life Tree : Ciona intestinalis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MTECPTVTTAYGKVRGKVLKSLGVSGSKEVYKFAGVPFAK
PPVGALRFEP PQKPDSWDGVKETTKSGPIPMQDARANAK
LLPYLMAHVDALETGFERSED CLYLDVYTPSTSDSSSLP
VMVWIYGGGLQNGFGNIYHAHCLCALYDVVVV VPTYRVN
ICGFLTLGADTKWPGNIGMLDQVAALKWTRDNVKGFGGDP
SNV TIFGESAGAFSVGLHVVSPMSKGLFHRAISHSGTAH
FPVLLSRSSKDALQ SLLEFLNIKETKPEVIVEKLKQVPM
QQLLEAQWKIQTEKGLFHIFYSCVD NKFITDDPLNIWKA
KGTAPVPYMVGCNNSEGDGILVAIVTDNDATEEKTL QFI
QDSLQAMETPANKMEEAVSIVLQKYATGLDNDKEKWMKMY
GALMRDL WFIVPSIMQCNAHAAAGRKTFLYYMTQQPRHN
HTNQYGAEIKNKPDHCEC DHADDILYTFGLPLFSKDQFK
PEVEFSEEDKTFSLHWMAYITNFAKYGDP NKGHDVPVNW
PTYDEANGYFLEASNEIRARKNLKPDTFEFWTKIIPAFIK
K

References

Title : The draft genome of Ciona intestinalis: insights into chordate and vertebrate origins - Dehal_2002_Science_298_2157
Author(s) : Dehal P , Satou Y , Campbell RK , Chapman J , Degnan B , De Tomaso A , Davidson B , Di Gregorio A , Gelpke M , Goodstein DM , Harafuji N , Hastings KE , Ho I , Hotta K , Huang W , Kawashima T , Lemaire P , Martinez D , Meinertzhagen IA , Necula S , Nonaka M , Putnam N , Rash S , Saiga H , Satake M , Terry A , Yamada L , Wang HG , Awazu S , Azumi K , Boore J , Branno M , Chin-Bow S , DeSantis R , Doyle S , Francino P , Keys DN , Haga S , Hayashi H , Hino K , Imai KS , Inaba K , Kano S , Kobayashi K , Kobayashi M , Lee BI , Makabe KW , Manohar C , Matassi G , Medina M , Mochizuki Y , Mount S , Morishita T , Miura S , Nakayama A , Nishizaka S , Nomoto H , Ohta F , Oishi K , Rigoutsos I , Sano M , Sasaki A , Sasakura Y , Shoguchi E , Shin-I T , Spagnuolo A , Stainier D , Suzuki MM , Tassy O , Takatori N , Tokuoka M , Yagi K , Yoshizaki F , Wada S , Zhang C , Hyatt PD , Larimer F , Detter C , Doggett N , Glavina T , Hawkins T , Richardson P , Lucas S , Kohara Y , Levine M , Satoh N , Rokhsar DS
Ref : Science , 298 :2157 , 2002
Abstract : Dehal_2002_Science_298_2157
ESTHER : Dehal_2002_Science_298_2157
PubMedSearch : Dehal_2002_Science_298_2157
PubMedID: 12481130
Gene_locus related to this paper: cioin-141645 , cioin-147959 , cioin-150181 , cioin-154370 , cioin-ACHE1 , cioin-ACHE2 , cioin-cxest , cioin-f6qcp0 , cioin-f6r8z1 , cioin-f6u176 , cioin-f6vac9 , cioin-f6x584 , cioin-f6xa69 , cioin-f6y403 , cioin-h2xqb4 , cioin-H2XTI0 , cioin-F6T1M3 , cioin-H2XUP7 , cioin-CIN.7233 , cioin-F6V269 , cioin-Cin16330 , cioin-h2xua2 , cioin-f6vaa5 , cioin-f6v9x6 , cioin-f6swc9 , cioin-f7amz2 , cioin-f6s021 , cioin-h2xxq9 , cioin-h2xne6 , cioin-f6ynr2

Title : A cDNA resource from the basal chordate Ciona intestinalis -
Author(s) : Satou Y , Yamada L , Mochizuki Y , Takatori N , Kawashima T , Sasaki A , Hamaguchi M , Awazu S , Yagi K , Sasakura Y , Nakayama A , Ishikawa H , Inaba K , Satoh N
Ref : Genesis , 33 :153 , 2002
PubMedID: 12203911
Gene_locus related to this paper: cioin-141645 , cioin-147959 , cioin-150181 , cioin-154370 , cioin-ACHE1 , cioin-ACHE2 , cioin-cxest , cioin-F6V269