cioin-h2xxq9

Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). Uncharacterized protein

Comment

Relationship

Family : SERHL

Block : X

Position in NCBI Life Tree : Ciona intestinalis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

RGISREIKIPINVGILCGRAFGNPKDPPVLCLHGWQDNCN
TFEKLIPLLP KNHYYVAMDMIGHGHSVGLPSEMMYDLRN
YIAMIHGMAKYMGWKSFTALG HSLGGCILICFAAVFPEM
IEKLILIESRIFWYPLSQAIKMLRSRVENVLQ TNEKSSD
RLYTYPEIKSRLQAFNKAIDDEAADILLERGISKEKDGKY
KVR RDKRIAKLPHFISEEMAVLCIKKLKAPTYHLLAVNG
FKNSHNLLENDKHL GLSDKPNHVYIEVKGNHFAHLSEPQ
GVADVVTKVLNGGVKVASKIL

References

Title : Complete mtDNA of Ciona intestinalis reveals extensive gene rearrangement and the presence of an atp8 and an extra trnM gene in ascidians - Gissi_2004_J.Mol.Evol_58_376
Author(s) : Gissi C , Iannelli F , Pesole G
Ref : Journal of Molecular Evolution , 58 :376 , 2004
Abstract : Gissi_2004_J.Mol.Evol_58_376
ESTHER : Gissi_2004_J.Mol.Evol_58_376
PubMedSearch : Gissi_2004_J.Mol.Evol_58_376
PubMedID: 15114417
Gene_locus related to this paper: cioin-f6swc9 , cioin-f7amz2 , cioin-f6s021 , cioin-h2xxq9 , cioin-h2xne6 , cioin-f6ynr2

Title : The draft genome of Ciona intestinalis: insights into chordate and vertebrate origins - Dehal_2002_Science_298_2157
Author(s) : Dehal P , Satou Y , Campbell RK , Chapman J , Degnan B , De Tomaso A , Davidson B , Di Gregorio A , Gelpke M , Goodstein DM , Harafuji N , Hastings KE , Ho I , Hotta K , Huang W , Kawashima T , Lemaire P , Martinez D , Meinertzhagen IA , Necula S , Nonaka M , Putnam N , Rash S , Saiga H , Satake M , Terry A , Yamada L , Wang HG , Awazu S , Azumi K , Boore J , Branno M , Chin-Bow S , DeSantis R , Doyle S , Francino P , Keys DN , Haga S , Hayashi H , Hino K , Imai KS , Inaba K , Kano S , Kobayashi K , Kobayashi M , Lee BI , Makabe KW , Manohar C , Matassi G , Medina M , Mochizuki Y , Mount S , Morishita T , Miura S , Nakayama A , Nishizaka S , Nomoto H , Ohta F , Oishi K , Rigoutsos I , Sano M , Sasaki A , Sasakura Y , Shoguchi E , Shin-I T , Spagnuolo A , Stainier D , Suzuki MM , Tassy O , Takatori N , Tokuoka M , Yagi K , Yoshizaki F , Wada S , Zhang C , Hyatt PD , Larimer F , Detter C , Doggett N , Glavina T , Hawkins T , Richardson P , Lucas S , Kohara Y , Levine M , Satoh N , Rokhsar DS
Ref : Science , 298 :2157 , 2002
Abstract : Dehal_2002_Science_298_2157
ESTHER : Dehal_2002_Science_298_2157
PubMedSearch : Dehal_2002_Science_298_2157
PubMedID: 12481130
Gene_locus related to this paper: cioin-141645 , cioin-147959 , cioin-150181 , cioin-154370 , cioin-ACHE1 , cioin-ACHE2 , cioin-cxest , cioin-f6qcp0 , cioin-f6r8z1 , cioin-f6u176 , cioin-f6vac9 , cioin-f6x584 , cioin-f6xa69 , cioin-f6y403 , cioin-h2xqb4 , cioin-H2XTI0 , cioin-F6T1M3 , cioin-H2XUP7 , cioin-CIN.7233 , cioin-F6V269 , cioin-Cin16330 , cioin-h2xua2 , cioin-f6vaa5 , cioin-f6v9x6 , cioin-f6swc9 , cioin-f7amz2 , cioin-f6s021 , cioin-h2xxq9 , cioin-h2xne6 , cioin-f6ynr2